NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209799_1012533

Scaffold Ga0209799_1012533


Overview

Basic Information
Taxon OID3300027654 Open in IMG/M
Scaffold IDGa0209799_1012533 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1829
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001831Metagenome / Metatranscriptome628Y
F063457Metagenome129Y
F089991Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0209799_10125332F001831GAGVEREVTAGLTRSAGLALLLAACAVANTPQQELAYARWAQCNSPAGRLERIDLDGRITFKYSSAGGRQEVLQCLADAGRAGPPLPEPIAVGLGGGP
Ga0209799_10125333F063457GGAVLVSYRLRKTGQVRGFAIVLPANADPHLVPTSAVIKCVADASGVPPEEIELLDLWNER
Ga0209799_10125334F089991N/AMAKSPPEKKAPPELRVLPMELKLGDRLADERSEWQVIGRPYTTGGGKTAHVRVESVNNPGVTEIRSWGSHERVGVKRDETKGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.