NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208454_1000459

Scaffold Ga0208454_1000459


Overview

Basic Information
Taxon OID3300027573 Open in IMG/M
Scaffold IDGa0208454_1000459 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23515
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (84.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8898Long. (o)-106.9077Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013841Metagenome268Y
F046265Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0208454_10004594F046265AGGMKISVIPWHVFIDALLKQQPNTLESWLRRWLFTNEGVIMADERIATNN
Ga0208454_10004595F013841AGGAGMKLLLATMFKKVPVRRTNQRATICKRCGTRIYSLSFLKVHLESHARNSH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.