 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F046265 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNISVIPWQVFLDALLKQQPSTLETWLRRWLFTNEGVIMADERIATNN |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.96 % |
| % of genes near scaffold ends (potentially truncated) | 17.22 % |
| % of genes from short scaffolds (< 2000 bps) | 75.50 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.563 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment (17.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (44.371 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.32% β-sheet: 0.00% Coil/Unstructured: 73.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF02900 | LigB | 8.61 |
| PF13090 | PP_kinase_C | 5.30 |
| PF00106 | adh_short | 1.99 |
| PF13561 | adh_short_C2 | 1.32 |
| PF07746 | LigA | 1.32 |
| PF02955 | GSH-S_ATP | 1.32 |
| PF13343 | SBP_bac_6 | 0.66 |
| PF03972 | MmgE_PrpD | 0.66 |
| PF04679 | DNA_ligase_A_C | 0.66 |
| PF04909 | Amidohydro_2 | 0.66 |
| PF07973 | tRNA_SAD | 0.66 |
| PF06305 | LapA_dom | 0.66 |
| PF00563 | EAL | 0.66 |
| PF06271 | RDD | 0.66 |
| PF00383 | dCMP_cyt_deam_1 | 0.66 |
| PF07044 | DUF1329 | 0.66 |
| PF06325 | PrmA | 0.66 |
| PF05635 | 23S_rRNA_IVP | 0.66 |
| PF08271 | TF_Zn_Ribbon | 0.66 |
| PF00501 | AMP-binding | 0.66 |
| PF00072 | Response_reg | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.66 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.66 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.66 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.66 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.66 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.66 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.56 % |
| Unclassified | root | N/A | 34.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102719280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1137 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1014965 | Not Available | 839 | Open in IMG/M |
| 3300000956|JGI10216J12902_117006357 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300004022|Ga0055432_10037472 | Not Available | 1106 | Open in IMG/M |
| 3300004024|Ga0055436_10299455 | Not Available | 519 | Open in IMG/M |
| 3300004463|Ga0063356_103776600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300004779|Ga0062380_10168244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 868 | Open in IMG/M |
| 3300005180|Ga0066685_10248778 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005294|Ga0065705_11099622 | Not Available | 523 | Open in IMG/M |
| 3300005353|Ga0070669_100841361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300005437|Ga0070710_11339311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300005445|Ga0070708_100167977 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300005446|Ga0066686_10118361 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300005447|Ga0066689_10144740 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300005450|Ga0066682_10297351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1042 | Open in IMG/M |
| 3300005545|Ga0070695_100811211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300005546|Ga0070696_100868777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300005713|Ga0066905_100401435 | Not Available | 1112 | Open in IMG/M |
| 3300005830|Ga0074473_11089909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300005833|Ga0074472_11402791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae | 1037 | Open in IMG/M |
| 3300005836|Ga0074470_10420545 | All Organisms → cellular organisms → Bacteria | 5277 | Open in IMG/M |
| 3300005836|Ga0074470_10479746 | Not Available | 574 | Open in IMG/M |
| 3300006797|Ga0066659_10519681 | Not Available | 957 | Open in IMG/M |
| 3300006844|Ga0075428_101651209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300006845|Ga0075421_101442210 | Not Available | 756 | Open in IMG/M |
| 3300006845|Ga0075421_101922083 | Not Available | 633 | Open in IMG/M |
| 3300006852|Ga0075433_10015660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6228 | Open in IMG/M |
| 3300006854|Ga0075425_100068542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3992 | Open in IMG/M |
| 3300006865|Ga0073934_10001301 | All Organisms → cellular organisms → Bacteria | 61010 | Open in IMG/M |
| 3300006904|Ga0075424_100928320 | Not Available | 928 | Open in IMG/M |
| 3300006969|Ga0075419_10846673 | Not Available | 657 | Open in IMG/M |
| 3300009012|Ga0066710_100308791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2320 | Open in IMG/M |
| 3300009053|Ga0105095_10164630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1212 | Open in IMG/M |
| 3300009100|Ga0075418_10785304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300009137|Ga0066709_101378524 | Not Available | 1027 | Open in IMG/M |
| 3300009147|Ga0114129_10281859 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300009162|Ga0075423_10556596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1207 | Open in IMG/M |
| 3300009444|Ga0114945_10160387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300009678|Ga0105252_10000539 | All Organisms → cellular organisms → Bacteria | 23444 | Open in IMG/M |
| 3300009820|Ga0105085_1037417 | Not Available | 863 | Open in IMG/M |
| 3300010036|Ga0126305_10238084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1166 | Open in IMG/M |
| 3300010040|Ga0126308_10119454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1636 | Open in IMG/M |
| 3300010042|Ga0126314_10369786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300010043|Ga0126380_10054454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2181 | Open in IMG/M |
| 3300010045|Ga0126311_10281488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1245 | Open in IMG/M |
| 3300010391|Ga0136847_12316966 | Not Available | 840 | Open in IMG/M |
| 3300010391|Ga0136847_12850813 | Not Available | 921 | Open in IMG/M |
| 3300011397|Ga0137444_1046635 | Not Available | 665 | Open in IMG/M |
| 3300011406|Ga0137454_1009825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1101 | Open in IMG/M |
| 3300011409|Ga0137323_1003134 | All Organisms → cellular organisms → Bacteria | 4169 | Open in IMG/M |
| 3300011419|Ga0137446_1181722 | Not Available | 509 | Open in IMG/M |
| 3300011427|Ga0137448_1075891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 885 | Open in IMG/M |
| 3300011435|Ga0137426_1002616 | All Organisms → cellular organisms → Bacteria | 4010 | Open in IMG/M |
| 3300011437|Ga0137429_1222554 | Not Available | 587 | Open in IMG/M |
| 3300011444|Ga0137463_1190680 | Not Available | 769 | Open in IMG/M |
| 3300011445|Ga0137427_10407319 | Not Available | 565 | Open in IMG/M |
| 3300012035|Ga0137445_1115621 | Not Available | 546 | Open in IMG/M |
| 3300012040|Ga0137461_1108369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300012133|Ga0137329_1026833 | Not Available | 708 | Open in IMG/M |
| 3300012137|Ga0137346_1052912 | Not Available | 555 | Open in IMG/M |
| 3300012201|Ga0137365_10691334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300012227|Ga0137449_1094863 | Not Available | 647 | Open in IMG/M |
| 3300012231|Ga0137465_1065793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300012360|Ga0137375_10035949 | All Organisms → cellular organisms → Bacteria | 5561 | Open in IMG/M |
| 3300012360|Ga0137375_10473407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300012896|Ga0157303_10174507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300012922|Ga0137394_11063923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300012931|Ga0153915_10238610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2009 | Open in IMG/M |
| 3300012948|Ga0126375_10973648 | Not Available | 688 | Open in IMG/M |
| 3300012964|Ga0153916_10006942 | All Organisms → cellular organisms → Bacteria | 8779 | Open in IMG/M |
| 3300014326|Ga0157380_13120872 | Not Available | 529 | Open in IMG/M |
| 3300014872|Ga0180087_1018629 | Not Available | 1229 | Open in IMG/M |
| 3300014879|Ga0180062_1021924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1314 | Open in IMG/M |
| 3300015251|Ga0180070_1011626 | Not Available | 944 | Open in IMG/M |
| 3300015371|Ga0132258_10156976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5464 | Open in IMG/M |
| 3300015371|Ga0132258_13978229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300015373|Ga0132257_102929108 | Not Available | 622 | Open in IMG/M |
| 3300017997|Ga0184610_1259138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300018000|Ga0184604_10033777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1319 | Open in IMG/M |
| 3300018027|Ga0184605_10338265 | Not Available | 680 | Open in IMG/M |
| 3300018028|Ga0184608_10044775 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300018028|Ga0184608_10096428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1230 | Open in IMG/M |
| 3300018031|Ga0184634_10102837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1249 | Open in IMG/M |
| 3300018031|Ga0184634_10174035 | Not Available | 974 | Open in IMG/M |
| 3300018031|Ga0184634_10528613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300018052|Ga0184638_1008580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3412 | Open in IMG/M |
| 3300018052|Ga0184638_1243952 | Not Available | 620 | Open in IMG/M |
| 3300018053|Ga0184626_10002323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6922 | Open in IMG/M |
| 3300018053|Ga0184626_10284546 | Not Available | 688 | Open in IMG/M |
| 3300018054|Ga0184621_10022780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1942 | Open in IMG/M |
| 3300018054|Ga0184621_10026011 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300018054|Ga0184621_10033958 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300018063|Ga0184637_10069628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2155 | Open in IMG/M |
| 3300018063|Ga0184637_10098643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1798 | Open in IMG/M |
| 3300018071|Ga0184618_10155229 | Not Available | 937 | Open in IMG/M |
| 3300018075|Ga0184632_10014788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3280 | Open in IMG/M |
| 3300018075|Ga0184632_10221249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300018076|Ga0184609_10364851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300018076|Ga0184609_10448438 | Not Available | 593 | Open in IMG/M |
| 3300018079|Ga0184627_10004320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6210 | Open in IMG/M |
| 3300018082|Ga0184639_10107507 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1475 | Open in IMG/M |
| 3300018082|Ga0184639_10346115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300018083|Ga0184628_10026002 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
| 3300018084|Ga0184629_10419974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300018422|Ga0190265_10164596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2188 | Open in IMG/M |
| 3300018422|Ga0190265_10558950 | Not Available | 1261 | Open in IMG/M |
| 3300018429|Ga0190272_13317197 | Not Available | 502 | Open in IMG/M |
| 3300018431|Ga0066655_10983437 | Not Available | 582 | Open in IMG/M |
| 3300019487|Ga0187893_10000927 | All Organisms → cellular organisms → Bacteria | 74033 | Open in IMG/M |
| 3300019878|Ga0193715_1005483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2719 | Open in IMG/M |
| 3300019884|Ga0193741_1145025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300020003|Ga0193739_1040414 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300020003|Ga0193739_1053262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300020060|Ga0193717_1075418 | Not Available | 1116 | Open in IMG/M |
| 3300020197|Ga0194128_10031887 | All Organisms → cellular organisms → Bacteria | 4412 | Open in IMG/M |
| 3300021051|Ga0206224_1001993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2028 | Open in IMG/M |
| 3300021081|Ga0210379_10054613 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300021090|Ga0210377_10036498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3478 | Open in IMG/M |
| 3300021332|Ga0210339_1214832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300022534|Ga0224452_1081036 | Not Available | 984 | Open in IMG/M |
| 3300022563|Ga0212128_10013482 | All Organisms → cellular organisms → Bacteria | 5249 | Open in IMG/M |
| 3300022756|Ga0222622_11361784 | Not Available | 522 | Open in IMG/M |
| 3300024241|Ga0233392_1019832 | Not Available | 686 | Open in IMG/M |
| 3300024241|Ga0233392_1031751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300025157|Ga0209399_10200027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300025310|Ga0209172_10000664 | All Organisms → cellular organisms → Bacteria | 90272 | Open in IMG/M |
| 3300025318|Ga0209519_10254729 | Not Available | 1026 | Open in IMG/M |
| 3300025324|Ga0209640_10082586 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300025324|Ga0209640_10450974 | Not Available | 1055 | Open in IMG/M |
| 3300025324|Ga0209640_10475517 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1022 | Open in IMG/M |
| 3300027573|Ga0208454_1000459 | All Organisms → cellular organisms → Bacteria | 23515 | Open in IMG/M |
| 3300027716|Ga0209682_10178374 | Not Available | 552 | Open in IMG/M |
| 3300027815|Ga0209726_10019600 | All Organisms → cellular organisms → Bacteria | 5845 | Open in IMG/M |
| 3300027815|Ga0209726_10149699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300027873|Ga0209814_10017540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2878 | Open in IMG/M |
| 3300027917|Ga0209536_100038057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6441 | Open in IMG/M |
| 3300031562|Ga0310886_10178008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300031901|Ga0307406_10480760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300032144|Ga0315910_10235317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1381 | Open in IMG/M |
| 3300032157|Ga0315912_10899633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300032401|Ga0315275_12634814 | Not Available | 518 | Open in IMG/M |
| 3300032829|Ga0335070_10302437 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300032829|Ga0335070_10367422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1382 | Open in IMG/M |
| 3300033414|Ga0316619_11527855 | Not Available | 599 | Open in IMG/M |
| 3300033433|Ga0326726_11966198 | Not Available | 569 | Open in IMG/M |
| 3300033513|Ga0316628_100013027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7319 | Open in IMG/M |
| 3300033513|Ga0316628_101247380 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300034177|Ga0364932_0224673 | Not Available | 711 | Open in IMG/M |
| 3300034894|Ga0373916_0028189 | Not Available | 733 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 17.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 13.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.65% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.99% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.99% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.32% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.32% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.32% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.32% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.66% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.66% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012137 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1027192801 | 3300000559 | Soil | MDIPVIPWNVFLDTLKKQQPGTLELWLRRWLFTNEGVIVADQQVLTTN* |
| KanNP_Total_noBrdU_T14TCDRAFT_10149651 | 3300000596 | Soil | MDTPLVPWQVFFDALKKQNPGTLELWLCRWLFTNEGVIEAD |
| JGI10216J12902_1170063573 | 3300000956 | Soil | MDIPLIPWNVFLDALKKQQPSTLELWLRRWLFTNEGVIVADQQMLITN* |
| Ga0055432_100374722 | 3300004022 | Natural And Restored Wetlands | MKISVIPWHVFIDALLKQQPNTLETWLRRWLFTNEGVIMADERVATGTFLERFV* |
| Ga0055436_102994551 | 3300004024 | Natural And Restored Wetlands | MKISVIPWHVFIDALLKQQPNTRENWLRRWLFTNEGVIMADERIATNN* |
| Ga0063356_1037766002 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEFPVIPWETFLDALQHQQPGTIEVWLRRWWFTNEGVIMADLSSAPTAN* |
| Ga0062380_101682442 | 3300004779 | Wetland Sediment | MEFPVIPWKVFLDALQHQQPGTLELWLRRWLFTNEGVIMDDSKLAENN* |
| Ga0066685_102487781 | 3300005180 | Soil | MDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQQMLNAN* |
| Ga0065705_110996222 | 3300005294 | Switchgrass Rhizosphere | MNFAVIPWQVFLDALQKQQPTNLDAWLRRWLFTNEGVLLAHQ |
| Ga0070669_1008413611 | 3300005353 | Switchgrass Rhizosphere | MNFAVIPWQVFLDALQKQQSTNLEAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0070710_113393112 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEISVIPWRVFFNTLRKQQSSTFELWLRRWLFNNEGAILADQRATAVN* |
| Ga0070708_1001679771 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDGRTQKRSRPMDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQQVLTTN |
| Ga0066686_101183613 | 3300005446 | Soil | MDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQQVLTTN* |
| Ga0066689_101447401 | 3300005447 | Soil | MDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQLMLTTN* |
| Ga0066682_102973512 | 3300005450 | Soil | MEISVIPWRVFFDTLRKQQSSTIELWLRRWLFTNEGAILADQRATAVN* |
| Ga0070695_1008112112 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFAVIPWQVFLDALQKQQPTNLDAWLRRWLFTNEGVLLAHQQTEMN* |
| Ga0070696_1008687771 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFAVIPWQVFLDALQKQQPTNLEAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0066905_1004014352 | 3300005713 | Tropical Forest Soil | MNICVIPWHVFLDALLKQQPQTLEIWLRRWLFTNEGVIMTRQQVTTNG* |
| Ga0074473_110899092 | 3300005830 | Sediment (Intertidal) | MVFPVIPWKVFLDALQHQQPSTLELWLRRWLFTNEGVIMADSTLANNS* |
| Ga0074472_114027912 | 3300005833 | Sediment (Intertidal) | MEFSFIPWQVFLEALKQQQAETRENWLRRWLFTDQGVIIATPQRMTP* |
| Ga0074470_104205458 | 3300005836 | Sediment (Intertidal) | MKISVIPWHVFIDALLKQQPNTRENWLRRWLFTNEGVIMADERIAANN* |
| Ga0074470_104797461 | 3300005836 | Sediment (Intertidal) | MNISVIPWHVFFEALKKQQPSTLEAWLRRWLFANEGVIISMAKKSLPMNG* |
| Ga0066659_105196813 | 3300006797 | Soil | MEISVIPWRVFFDTLRKQQSSTIELWLRRWLLTNEGAILADQRATAVN* |
| Ga0075428_1016512091 | 3300006844 | Populus Rhizosphere | MNISVIPWHIFLDALKKQQPGTLELWLRRWRFTNEGVIVAEKMLNAN* |
| Ga0075421_1014422102 | 3300006845 | Populus Rhizosphere | MNFTVIPWQVFLDALQKQQPTNLEAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0075421_1019220831 | 3300006845 | Populus Rhizosphere | MNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIVTNN* |
| Ga0075433_100156603 | 3300006852 | Populus Rhizosphere | MDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVGDQEVLTIN* |
| Ga0075425_1000685426 | 3300006854 | Populus Rhizosphere | MEISVIPWRVFLDTLRKQQSSTIELWLRRWLFTNEGAILADQRATAVN* |
| Ga0073934_1000130123 | 3300006865 | Hot Spring Sediment | MKISVIPWHVFIEALLQQEPSTLELWLRRWLFTNEGVIIAHERTTAENSVT* |
| Ga0075424_1009283202 | 3300006904 | Populus Rhizosphere | MEISVIPWRVFLDTLRKQQSSTIELWLRRWLFTNEGAILADQRAQAV |
| Ga0075419_108466733 | 3300006969 | Populus Rhizosphere | MNFTVIPWQVFLDALQKQQPTNLEAWLRRWLFTNEGVLLANQQTETN* |
| Ga0066710_1003087912 | 3300009012 | Grasslands Soil | MEISVTPWRVFFDTLRKQQSSTIELWLRRWLFTNEGAILADQRATAVN |
| Ga0105095_101646304 | 3300009053 | Freshwater Sediment | IPWHVFLDALQKQQSASIELWLRRWLFTNEGVILAHHRVGASN* |
| Ga0075418_107853042 | 3300009100 | Populus Rhizosphere | MNISVIPWHIFLDALKKQQPGTLELWLRRWLFTNEGVIVAEKMLNAN* |
| Ga0066709_1013785241 | 3300009137 | Grasslands Soil | MEISVIPWRMFFDTLRKQQSSTPELWLRRWLFTNEGAIL |
| Ga0114129_102818594 | 3300009147 | Populus Rhizosphere | MNISVIPWSVFLDALKQQQPSTLELWLRRWLFTNEGVILANQRVFNAN* |
| Ga0075423_105565963 | 3300009162 | Populus Rhizosphere | MNFAVIPWQVFLDALQKQQPTNLDAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0114945_101603872 | 3300009444 | Thermal Springs | MEFSLIPWRVFLEALKQQRPGTLEVWLRRWLFTNEGVILAVVKK* |
| Ga0105252_1000053922 | 3300009678 | Soil | VKKKMKISVIPWHVFIDALLKQQPNTLESWLRRWLFTNEGVIMADERIATNN* |
| Ga0105085_10374171 | 3300009820 | Groundwater Sand | MNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIATNN* |
| Ga0126305_102380841 | 3300010036 | Serpentine Soil | MEFPVIPWKTFFEALQHQQPGTIEVWLRRWWFTNEGVIMADLSSAPNAN* |
| Ga0126308_101194542 | 3300010040 | Serpentine Soil | MEFPVIPWETFLDALQHQQPGTIEVWLRRWWFTNEGVIMADLSSAPNAN* |
| Ga0126314_103697861 | 3300010042 | Serpentine Soil | MEFPVIPWKTFLEALQHQQPGTIEVWLRRWWFTNEGVIMADLSSAPNVN* |
| Ga0126380_100544543 | 3300010043 | Tropical Forest Soil | MNICVIPWHVFLDALLKQQPQTLEIWLRRWLFTNEGVI |
| Ga0126311_102814881 | 3300010045 | Serpentine Soil | MEFPVIPWETFLDALQHQQPGTMEVWLRRWWFTNEGVIMADLSSALNAN* |
| Ga0136847_123169661 | 3300010391 | Freshwater Sediment | MNISVIPWQVFLDALLKQQPSTLETWLRRWLFTNEGVIMADERIAANN* |
| Ga0136847_128508132 | 3300010391 | Freshwater Sediment | MNISVIPWQVFLDALLKQQPSTLETWLRRWLFTNEGVIMANERIATNN* |
| Ga0137444_10466352 | 3300011397 | Soil | MNIAVIPWQVFLDALQKQPPTALEAWLRRWLFTNEGVLLAHQQTGTNLG* |
| Ga0137454_10098251 | 3300011406 | Soil | MEFPVIPWKVFLDALQQQQPGMLEAWLRRCLFTNEGVIMADSALATNNQAS* |
| Ga0137323_10031341 | 3300011409 | Soil | VKKKMKISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADE |
| Ga0137446_11817222 | 3300011419 | Soil | MNFAIIPWQVFLDALQKQQPNALEAWLRRWLFTNEGVLLAHQQIGTN* |
| Ga0137448_10758911 | 3300011427 | Soil | MNITVIPWHVFRDALLKQQPQTLESWLRRWLFTNEGVIMVHGRVASNN* |
| Ga0137426_10026164 | 3300011435 | Soil | MNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIAANN* |
| Ga0137429_12225541 | 3300011437 | Soil | KKTMNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIAANN* |
| Ga0137463_11906801 | 3300011444 | Soil | MNITIIPWHVFRDALLKQQPQTLESWLRRWLFTNEGVIMAHRRVASNN* |
| Ga0137427_104073191 | 3300011445 | Soil | MEFPIIPWKVFLDALQHQQASNLEPWLRRWWFTNEGVLMESSAWQEM |
| Ga0137445_11156212 | 3300012035 | Soil | MNIAVIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVLLAHQQPETNQG* |
| Ga0137461_11083692 | 3300012040 | Soil | MNIAVIPWQVFLDALQKQQPTTLEAWLRRWLFTDDGVLLAHQQTAMN* |
| Ga0137329_10268331 | 3300012133 | Soil | MNITVIPWHVFRDALLKQQPQTLESWLRRWLFTNEGVIM |
| Ga0137346_10529121 | 3300012137 | Soil | MNIAVIPWQVFLDALQKQQPTTLEAWLRRWLFTNDGVLLAHQQTAKN* |
| Ga0137365_106913341 | 3300012201 | Vadose Zone Soil | MEISVIPWRVFFDTLRKQQSSTIELWLRRWLFTNEGPILADQRATAVN* |
| Ga0137449_10948631 | 3300012227 | Soil | MEFPIIPWKVFLDALQHQQASNLELWLRRWWFTDEGVIMESSAW |
| Ga0137465_10657933 | 3300012231 | Soil | QVFLDALQKQQSTNLEAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0137375_100359496 | 3300012360 | Vadose Zone Soil | MDISLIPWNVFLDALKKQRPGTLELWLRQWLFTNEGVIDADEQVLTPINW* |
| Ga0137375_104734073 | 3300012360 | Vadose Zone Soil | MDIPVIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQQVLSTN* |
| Ga0157334_10003741 | 3300012509 | Soil | MELSIIPWQVFIETLHKQQSGTVELWLRSWLFSNEGVMLAD |
| Ga0157303_101745072 | 3300012896 | Soil | MNFAVIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0137394_110639232 | 3300012922 | Vadose Zone Soil | MEISVIPWRVFFDTLRKQQSSTIELSLRRWLFTNEGAILADQRATAVN* |
| Ga0153915_102386103 | 3300012931 | Freshwater Wetlands | MRIAVIPWHVFFAALKQQQPSTLENWLRRWLFTNEGVIMSMARK* |
| Ga0126375_109736482 | 3300012948 | Tropical Forest Soil | MKISVIPWHVFIDALLKQQPSTLEVWLRRWLFTNEGVIMADERIGANQ* |
| Ga0153916_100069427 | 3300012964 | Freshwater Wetlands | MEFSFIPWQVFLEALKQQQASTRDNWLRRWLFTDQGVIIATPQKITP* |
| Ga0075344_10485953 | 3300014296 | Natural And Restored Wetlands | MEFPLIPWNVFLDALQHQQPSTLEPWLRRWWFTNEGVIMESSALQ |
| Ga0157380_131208721 | 3300014326 | Switchgrass Rhizosphere | MNFVVIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVL |
| Ga0180087_10186293 | 3300014872 | Soil | MNISVIPWHVFIDALLKQQPHTLESWLRRWLFTNEGVIMADERIAAIN* |
| Ga0180062_10219241 | 3300014879 | Soil | TMNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIAANN* |
| Ga0180070_10116263 | 3300015251 | Soil | MNIAVIPWQVFLDALQKQQPTTLEAWLLRWLFTDDGVLLAHQQTAMN* |
| Ga0132258_101569762 | 3300015371 | Arabidopsis Rhizosphere | MNFVVIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVLLAHQQTETN* |
| Ga0132258_139782292 | 3300015371 | Arabidopsis Rhizosphere | MEFPVIPWKVFLEALEHQQPSTLELWLRRWLFTNEGVIMADSTSATHG* |
| Ga0132257_1029291082 | 3300015373 | Arabidopsis Rhizosphere | MEFPVIPWKVFLEALEHQQPSTLELWLRRWLFTNEGVIMADSTSATHS* |
| Ga0184610_12591382 | 3300017997 | Groundwater Sediment | MNIAIIPWQVFLDALQKQQPSNLEGWLRRWLFTNEGVLLAHQQIGTN |
| Ga0184604_100337772 | 3300018000 | Groundwater Sediment | MDISLIPWNVFLDALKKQRPGTLELWLRQWPFTNEGVIDADEQTLTPINW |
| Ga0184605_103382651 | 3300018027 | Groundwater Sediment | MDISLIPWNVFLDALKKQRHGTLELWLRQWLFTNEGVIDADEQTLTPINW |
| Ga0184608_100447752 | 3300018028 | Groundwater Sediment | MDISLIPWNVFLDALKKQRPGTLELWLRQWLFTNEGVIDADEQTLTPINW |
| Ga0184608_100964282 | 3300018028 | Groundwater Sediment | MDISLIPWQVFLDALKKQQPGTLELWLRRWLFTNEGVIQADPRVVTLS |
| Ga0184634_101028372 | 3300018031 | Groundwater Sediment | MDLSLIPWQVFLDALKKQQPSTVELWLRRWLFTNEGVIQADPRVVTIN |
| Ga0184634_101740352 | 3300018031 | Groundwater Sediment | MNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIAANN |
| Ga0184634_105286132 | 3300018031 | Groundwater Sediment | MNIAVIPWQVFLDALQKQQPNNLEGWLRRWLFTNEGVLLAHQQIGTN |
| Ga0184638_10085804 | 3300018052 | Groundwater Sediment | MDISLIPWQVFLDALKKQKPGTLELWLRRWLFTNEGVIQADPRFATLN |
| Ga0184638_12439521 | 3300018052 | Groundwater Sediment | MNISLIPWQVFLDALKKQQPSTVELWLRRWLFTNEGVIQADPRV |
| Ga0184626_100023237 | 3300018053 | Groundwater Sediment | MNISLIPWQVFLDALKKQQPSTVELWLGRWLFTNEGVIQADPRVVTIS |
| Ga0184626_102845461 | 3300018053 | Groundwater Sediment | MDISLIPWQVFLDALKKQKPGTLELWLRRWLFTNEGVIQADPRVVTIS |
| Ga0184621_100227802 | 3300018054 | Groundwater Sediment | MDISLIPWQVFLDALKKQQPGTLELWLRRWLFTNEGVIQADTRVVTLS |
| Ga0184621_100260114 | 3300018054 | Groundwater Sediment | MNFAVIPWQVFLDALQKQQPTNLEAWLRRWLFTNEGVLLAHQQTETN |
| Ga0184621_100339581 | 3300018054 | Groundwater Sediment | MDISLIPWNVFLDALKKQRPGTLELWLRQWLFTNEGVIDADEQVLTPIN |
| Ga0184637_100696283 | 3300018063 | Groundwater Sediment | MNISVIPWQVFLDALLKQQPSTLETWLRRWLFTNEGVIMADERIATNN |
| Ga0184637_100986432 | 3300018063 | Groundwater Sediment | MDLSLIPWQVFLDALKKLQPSTVELWLRRWLFTNEGVIQADPRVVTIN |
| Ga0184618_101552294 | 3300018071 | Groundwater Sediment | MNFALIPWQVFLDALQKQQPTALDAWLRRWLFTNEGVLLAHQ |
| Ga0184632_100147886 | 3300018075 | Groundwater Sediment | MDISLIPWQVFLDALKKQQPSTVELWLGRWLFTNEGVIQADPRVVTIS |
| Ga0184632_102212492 | 3300018075 | Groundwater Sediment | MDISLIPWNVFLDALKKQRPGTLELWLRQWLFTNEGVIDADEQVLTPINW |
| Ga0184609_103648513 | 3300018076 | Groundwater Sediment | MNFALIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVLLAHQQTETN |
| Ga0184609_104484381 | 3300018076 | Groundwater Sediment | MNISLIPWQVFLDALKKQQPSTVELWLRRWLFTNEGVIQADPRVVTIS |
| Ga0184627_100043208 | 3300018079 | Groundwater Sediment | MDLSLIPWQVFLDALKKQQPSTVELWLRRWLFTHEGVIQADPRVVTIN |
| Ga0184639_101075071 | 3300018082 | Groundwater Sediment | KMKISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIATNN |
| Ga0184639_103461152 | 3300018082 | Groundwater Sediment | MEFSLIPWRVFLEALTKQRPGTLEVWLRRWLFTNEGVIVAVAKK |
| Ga0184628_100260024 | 3300018083 | Groundwater Sediment | MNFVVIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVLLAHQQTETN |
| Ga0184629_104199742 | 3300018084 | Groundwater Sediment | MNIAVIPWQVFLDALQKQQPNNLEAWLRRWLFTNEGVLLANQ |
| Ga0190265_101645964 | 3300018422 | Soil | MDISVIPWHVFLDALKKQQSTTIELWLRRWLFTNEGVILAHHRVGANH |
| Ga0190265_105589502 | 3300018422 | Soil | MEISVIPWHVFLDALKKQQSTTIELWLRRWLFTNEGVILAHHRVGANN |
| Ga0190272_133171972 | 3300018429 | Soil | MDISVIPWHVFLDALKKQQSTTIELWLRRWLFTNEGVILAHHRVGA |
| Ga0066655_109834372 | 3300018431 | Grasslands Soil | MDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQQMLNAN |
| Ga0187893_1000092759 | 3300019487 | Microbial Mat On Rocks | MKISVIPWHVFIDALKKQQPAVLEFWLKRWLFANDGVFISQARK |
| Ga0193715_10054832 | 3300019878 | Soil | MEISVIPWRVFFDTLRKQQSSTIELWLRRWLFTNEGAILADQRATAVN |
| Ga0193741_11450252 | 3300019884 | Soil | MNFAVIPWQVFLDALQKQQSTNLEAWLRRWLFTNEGVLLAHQQTETN |
| Ga0193739_10404141 | 3300020003 | Soil | MDISLIPWQVFLDTLKKQQPGTLELWLRRWLFTNEGVIQADPRVVTIN |
| Ga0193739_10532622 | 3300020003 | Soil | MNFAVIPWQVFLDALQKQQPTTLEAWLRRWLFTNEGVLLAHQQTETN |
| Ga0193717_10754181 | 3300020060 | Soil | MDISVIPWHVFLDALQKQQSTTVELWLRRWLFTNEGVILAHHRVGANN |
| Ga0194128_100318874 | 3300020197 | Freshwater Lake | MQISVIPWHVFIDALLKQQPGTLEVWLRRWLFTNEGVIMADDRIAANNV |
| Ga0206224_10019935 | 3300021051 | Deep Subsurface Sediment | MNIAVIPWQVFLDALQKQQPTTLEAWLRRWLFTNDGVLLAHQQTAMN |
| Ga0210379_100546133 | 3300021081 | Groundwater Sediment | MNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIVTNN |
| Ga0210377_100364986 | 3300021090 | Groundwater Sediment | MDISVIPWHVFLDALQKQQSTSIELWLRRWLFTNEGVILAHHRVGANN |
| Ga0210339_12148322 | 3300021332 | Estuarine | MVFPVIPWKVFLDALQHQQPSTLELWLRRWLFTNEGVIMADSTLANNS |
| Ga0224452_10810361 | 3300022534 | Groundwater Sediment | MDISLIPWNVFLDALKKQRPGTLELWLRQWLFTNEGVIDADEQTLTSINW |
| Ga0212128_100134828 | 3300022563 | Thermal Springs | MEFSLIPWRVFLEALKQQRPGTIEVWLRRWLFTNEGVILAVIKK |
| Ga0222622_113617841 | 3300022756 | Groundwater Sediment | MNISLIPWQVFLDALQKQQPTNLEPWLRHWLFTNEGVIM |
| Ga0233392_10198321 | 3300024241 | Deep Subsurface Sediment | MNILVIPWQVFLDALLKQQPSTLETWLRRWLFTNEGVIMAHDKIATNN |
| Ga0233392_10317511 | 3300024241 | Deep Subsurface Sediment | MNIAVIPWQVFLDALQKQQPTTLEAWLRRWLFTDDGVLLAHQQTAMN |
| Ga0209399_102000272 | 3300025157 | Thermal Springs | MEFSLIPWRVFLEALKQQRPGTLEVWLRRWLFTNEGVILAVVKK |
| Ga0209172_1000066423 | 3300025310 | Hot Spring Sediment | MKISVIPWHVFIEALLQQEPSTLELWLRRWLFTNEGVIIAHERTTAENSVT |
| Ga0209519_102547294 | 3300025318 | Soil | MLVNVRGNAMQLSLIPWRMFLDALEKQNPSTQETWLRRWLFTDEGVII |
| Ga0209640_100825865 | 3300025324 | Soil | MNISVIPWHVFIDALLKQQPSTLETWLRRWLFTNEGVIMADERIATYN |
| Ga0209640_104509743 | 3300025324 | Soil | MQLSLIPWRMFLDALKKQNPSTTETWLRRWLFTDEGVIIAAPEKHS |
| Ga0209640_104755172 | 3300025324 | Soil | MNISVIPWQVFLDALIKQQPNTRENWLRRWLFTNEGVIMADERIAVNN |
| Ga0208454_10004594 | 3300027573 | Soil | MKISVIPWHVFIDALLKQQPNTLESWLRRWLFTNEGVIMADERIATNN |
| Ga0209682_101783742 | 3300027716 | Wetland Sediment | MEFPVIPWKVFLDALQHQQPGTLELWLRRWLFTNEGVIMDDSKLAENN |
| Ga0209726_100196008 | 3300027815 | Groundwater | MNIRVIPWHMFHDALLRQPPQTLESWLRRWLFTNEGVIMAHRRVASNN |
| Ga0209726_101496993 | 3300027815 | Groundwater | MDFPVIPWKVFLDALQHQQPGTLELWLRRWLFTNEGVIMDDTKLANNN |
| Ga0209814_100175402 | 3300027873 | Populus Rhizosphere | MDIPLIPWNVFLDALKKQQPGTLELWLRRWLFTNEGVIVADQQVLTTN |
| Ga0209536_10003805711 | 3300027917 | Marine Sediment | MTFSLIPWFVFLDALKKQSPATLEVWLRRWLFTNEGVFPDRARK |
| Ga0310886_101780082 | 3300031562 | Soil | MEFPVIPWETFLDALQHQQPGTIEVWLRRWWFTNEGVIMADLSSAPTAN |
| Ga0307406_104807603 | 3300031901 | Rhizosphere | MEFPVIRWETFLDALQHQQPGTIEVWLRRWWFTNKGVIMADLSSAPNAN |
| Ga0315910_102353173 | 3300032144 | Soil | MDIPVIPWHVFLDALKKQQPTTIEIWLRRWLFTNEGVILANHHVSTIR |
| Ga0315912_108996332 | 3300032157 | Soil | MELPVIPWEIFLDALQHQQPGTIEVWLRRWWFTNEGVIMADLSSAPTAN |
| Ga0315275_126348141 | 3300032401 | Sediment | MNITVIPWHVFRDALLRQQPQTLESWLRRWLFTNEGVIMVHHS |
| Ga0335070_103024374 | 3300032829 | Soil | MEISMIPWHVFLDALNKQQPTTLEIWLRRWLFTNEGVILASQRTASSH |
| Ga0335070_103674221 | 3300032829 | Soil | MTISVIPWNVFFEALKKQQPNTRDLWLRRWLFANEGVIMSAAKK |
| Ga0316619_115278551 | 3300033414 | Soil | MEFPIIPWNVFLDALQHQQASTLEPWLRRWWFTNEGVIME |
| Ga0326726_119661981 | 3300033433 | Peat Soil | MKIAVIPWHVFFQALKQQKPSTLENWLRRWLFTNEGVIVSMARK |
| Ga0316628_1000130275 | 3300033513 | Soil | MNISVIPWQVFFEALKKQQPSTLEAWLRRWLFANEGVLISMAKK |
| Ga0316628_1012473802 | 3300033513 | Soil | MNISVIPWQVFFEALNKQKPSTLEAWLRRWLFANEGVVMSMPKK |
| Ga0364932_0224673_122_277 | 3300034177 | Sediment | MEISVIPWHVFIDALKKQQPGTIELWLRRWLYTNEGVILANPTPFSTAKVA |
| Ga0373916_0028189_141_287 | 3300034894 | Sediment Slurry | MKISVIPWHVFIDALLKQQPSTLEVWLRRWLFTNEGVIMADERIATNN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |