| Basic Information | |
|---|---|
| Taxon OID | 3300027514 Open in IMG/M |
| Scaffold ID | Ga0208338_1000014 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 88299 |
| Total Scaffold Genes | 68 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 46 (67.65%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Browns Valley, California, USA | |||||||
| Coordinates | Lat. (o) | 39.23550963 | Long. (o) | -121.2836963 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024411 | Metagenome | 206 | Y |
| F033850 | Metagenome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208338_100001413 | F024411 | AGGAG | MCPICMTNAVLVAAGATSGAGVLGFVAVKVRALRRYRREPRSAIGFKKE |
| Ga0208338_100001434 | F033850 | AGGA | MPTNYSLDVAFSSTTRSIPNNSTRPILAMGYGFSEQAPGGSWHEQGQGVLSVRAGSPVVFTAFDTAPGNAQKVTTFEVDFPNKNNPFVDEHGKPIGTPSSIVVTGNNIASQNGQSAGCNVVGLYSMIGPYYINAAIGSKIVCTVKITLRNGQVFQVDPEMQVEGGGIEVGKSTYAT |
| ⦗Top⦘ |