Basic Information | |
---|---|
Family ID | F024411 |
Family Type | Metagenome |
Number of Sequences | 206 |
Average Sequence Length | 51 residues |
Representative Sequence | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 206 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 87.25 % |
% of genes near scaffold ends (potentially truncated) | 11.17 % |
% of genes from short scaffolds (< 2000 bps) | 75.73 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.573 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.136 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.913 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (68.932 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.75% β-sheet: 0.00% Coil/Unstructured: 46.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 206 Family Scaffolds |
---|---|---|
PF05988 | DUF899 | 58.25 |
PF03795 | YCII | 4.37 |
PF00395 | SLH | 1.46 |
PF04542 | Sigma70_r2 | 0.97 |
PF08241 | Methyltransf_11 | 0.97 |
PF13590 | DUF4136 | 0.97 |
PF01850 | PIN | 0.49 |
PF01084 | Ribosomal_S18 | 0.49 |
PF13243 | SQHop_cyclase_C | 0.49 |
PF02265 | S1-P1_nuclease | 0.49 |
PF13428 | TPR_14 | 0.49 |
PF13181 | TPR_8 | 0.49 |
PF12704 | MacB_PCD | 0.49 |
PF02574 | S-methyl_trans | 0.49 |
PF01137 | RTC | 0.49 |
PF01814 | Hemerythrin | 0.49 |
PF09832 | DUF2059 | 0.49 |
PF08282 | Hydrolase_3 | 0.49 |
PF02668 | TauD | 0.49 |
PF06537 | DHOR | 0.49 |
PF02371 | Transposase_20 | 0.49 |
PF13429 | TPR_15 | 0.49 |
PF01494 | FAD_binding_3 | 0.49 |
PF00942 | CBM_3 | 0.49 |
PF13349 | DUF4097 | 0.49 |
PF03551 | PadR | 0.49 |
PF00311 | PEPcase | 0.49 |
PF13432 | TPR_16 | 0.49 |
PF02567 | PhzC-PhzF | 0.49 |
PF00300 | His_Phos_1 | 0.49 |
PF09843 | DUF2070 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
---|---|---|---|
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 58.25 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.37 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.97 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.49 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.49 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.49 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.49 |
COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.49 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.49 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.49 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.49 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.49 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.49 |
COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.49 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.49 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.49 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.49 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.49 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.49 |
COG0430 | RNA 3'-terminal phosphate cyclase | RNA processing and modification [A] | 0.49 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.57 % |
Unclassified | root | N/A | 2.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_101907233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
3300001464|JGI12363J15224_100168 | All Organisms → cellular organisms → Bacteria | 14922 | Open in IMG/M |
3300004114|Ga0062593_103140529 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300004479|Ga0062595_100524267 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300005238|Ga0073692_1028110 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005289|Ga0065704_10000988 | All Organisms → cellular organisms → Bacteria | 17860 | Open in IMG/M |
3300005290|Ga0065712_10068035 | All Organisms → cellular organisms → Bacteria | 16451 | Open in IMG/M |
3300005290|Ga0065712_10152893 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300005293|Ga0065715_10388348 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300005295|Ga0065707_10088817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4528 | Open in IMG/M |
3300005295|Ga0065707_10685137 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005331|Ga0070670_100000095 | All Organisms → cellular organisms → Bacteria | 83302 | Open in IMG/M |
3300005332|Ga0066388_102610676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300005337|Ga0070682_100064534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2324 | Open in IMG/M |
3300005340|Ga0070689_100000144 | All Organisms → cellular organisms → Bacteria | 41278 | Open in IMG/M |
3300005340|Ga0070689_102097315 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005343|Ga0070687_101080366 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005345|Ga0070692_10051158 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300005353|Ga0070669_100009031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7108 | Open in IMG/M |
3300005364|Ga0070673_101343828 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005364|Ga0070673_102386539 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005364|Ga0070673_102404624 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005438|Ga0070701_10247470 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300005441|Ga0070700_100660319 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300005518|Ga0070699_100025173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5132 | Open in IMG/M |
3300005518|Ga0070699_100072473 | All Organisms → cellular organisms → Bacteria | 2996 | Open in IMG/M |
3300005535|Ga0070684_101864535 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005539|Ga0068853_101430075 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300005545|Ga0070695_101138674 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005564|Ga0070664_100647905 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300005577|Ga0068857_100586675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1052 | Open in IMG/M |
3300005577|Ga0068857_100610369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1032 | Open in IMG/M |
3300005577|Ga0068857_100755365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 926 | Open in IMG/M |
3300005578|Ga0068854_101356014 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005616|Ga0068852_101573568 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005617|Ga0068859_100005861 | All Organisms → cellular organisms → Bacteria | 12470 | Open in IMG/M |
3300005617|Ga0068859_100025196 | All Organisms → cellular organisms → Bacteria | 5969 | Open in IMG/M |
3300005617|Ga0068859_100115877 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
3300005617|Ga0068859_100210472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2031 | Open in IMG/M |
3300005617|Ga0068859_100324479 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300005618|Ga0068864_100190369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1880 | Open in IMG/M |
3300005618|Ga0068864_101852447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300005719|Ga0068861_101020763 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005840|Ga0068870_10038984 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300005840|Ga0068870_10671728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
3300005841|Ga0068863_100169783 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300005841|Ga0068863_100187009 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
3300005841|Ga0068863_102175781 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005843|Ga0068860_100504842 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300005844|Ga0068862_102453984 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005985|Ga0081539_10059606 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
3300006169|Ga0082029_1148849 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300006169|Ga0082029_1213481 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
3300006755|Ga0079222_10480009 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300006844|Ga0075428_102115684 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300006845|Ga0075421_100059793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4817 | Open in IMG/M |
3300006852|Ga0075433_10217860 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
3300006852|Ga0075433_10366356 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300006852|Ga0075433_10708107 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300006853|Ga0075420_100029649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4890 | Open in IMG/M |
3300006854|Ga0075425_100422686 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
3300006876|Ga0079217_10053325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1634 | Open in IMG/M |
3300006876|Ga0079217_10135333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1168 | Open in IMG/M |
3300006876|Ga0079217_11014606 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300006880|Ga0075429_101629280 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300006904|Ga0075424_102622906 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300006918|Ga0079216_10275393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
3300007004|Ga0079218_10837541 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300007004|Ga0079218_11239034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
3300007004|Ga0079218_13470213 | Not Available | 535 | Open in IMG/M |
3300009011|Ga0105251_10264694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
3300009101|Ga0105247_10856375 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300009147|Ga0114129_11360036 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 878 | Open in IMG/M |
3300009147|Ga0114129_12966577 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009148|Ga0105243_10014735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5913 | Open in IMG/M |
3300009148|Ga0105243_10317970 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300009148|Ga0105243_11495092 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300009148|Ga0105243_12439629 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300009156|Ga0111538_11653882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
3300009157|Ga0105092_10131473 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300009162|Ga0075423_10772441 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300009162|Ga0075423_11745850 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009162|Ga0075423_12313629 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300009174|Ga0105241_10352968 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300009174|Ga0105241_10537309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1048 | Open in IMG/M |
3300009174|Ga0105241_10886231 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300009174|Ga0105241_11566474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300009176|Ga0105242_10016393 | All Organisms → cellular organisms → Bacteria | 5759 | Open in IMG/M |
3300009176|Ga0105242_10499102 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300009177|Ga0105248_11584218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 742 | Open in IMG/M |
3300009545|Ga0105237_10162939 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
3300009551|Ga0105238_11208511 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300009553|Ga0105249_10002216 | All Organisms → cellular organisms → Bacteria | 16843 | Open in IMG/M |
3300009789|Ga0126307_10399057 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300009840|Ga0126313_10635337 | Not Available | 862 | Open in IMG/M |
3300010038|Ga0126315_10071223 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
3300010038|Ga0126315_10237906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1108 | Open in IMG/M |
3300010039|Ga0126309_10248103 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300010041|Ga0126312_10374543 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300010041|Ga0126312_10665479 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300010042|Ga0126314_10208483 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300010042|Ga0126314_10433975 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300010044|Ga0126310_10213309 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300010044|Ga0126310_11035162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
3300010045|Ga0126311_10000050 | All Organisms → cellular organisms → Bacteria | 61153 | Open in IMG/M |
3300010045|Ga0126311_11456508 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300010045|Ga0126311_11840000 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010046|Ga0126384_11573010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 618 | Open in IMG/M |
3300010166|Ga0126306_10115431 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
3300010359|Ga0126376_11425864 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300010359|Ga0126376_11562404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
3300010362|Ga0126377_11938465 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300010373|Ga0134128_10012322 | All Organisms → cellular organisms → Bacteria | 10197 | Open in IMG/M |
3300010397|Ga0134124_10350068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1391 | Open in IMG/M |
3300010397|Ga0134124_10769961 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300010397|Ga0134124_11679321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300010399|Ga0134127_10912099 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300010399|Ga0134127_12337317 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010399|Ga0134127_13279375 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010401|Ga0134121_10001450 | All Organisms → cellular organisms → Bacteria | 22321 | Open in IMG/M |
3300010401|Ga0134121_10001475 | All Organisms → cellular organisms → Bacteria | 22093 | Open in IMG/M |
3300011119|Ga0105246_11121828 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300011119|Ga0105246_11187613 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300011119|Ga0105246_11697710 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012015|Ga0120187_1000609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1866 | Open in IMG/M |
3300013297|Ga0157378_10452488 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300013308|Ga0157375_12904282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
3300013500|Ga0120195_1000047 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
3300014325|Ga0163163_10000026 | All Organisms → cellular organisms → Bacteria | 179198 | Open in IMG/M |
3300014325|Ga0163163_12710526 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300014326|Ga0157380_10553313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1129 | Open in IMG/M |
3300014745|Ga0157377_10059968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2171 | Open in IMG/M |
3300014745|Ga0157377_10657485 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300014968|Ga0157379_10701618 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300015371|Ga0132258_12523903 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300015374|Ga0132255_101845578 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 919 | Open in IMG/M |
3300018466|Ga0190268_12157268 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018476|Ga0190274_10326730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1444 | Open in IMG/M |
3300018476|Ga0190274_10679902 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300019377|Ga0190264_11407301 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300025735|Ga0207713_1180258 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300025900|Ga0207710_10204457 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300025900|Ga0207710_10597595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300025907|Ga0207645_10886565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
3300025908|Ga0207643_10075568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1944 | Open in IMG/M |
3300025908|Ga0207643_11041086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → Nostoc linckia | 529 | Open in IMG/M |
3300025917|Ga0207660_10961770 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300025921|Ga0207652_10029488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4589 | Open in IMG/M |
3300025922|Ga0207646_10056474 | All Organisms → cellular organisms → Bacteria | 3509 | Open in IMG/M |
3300025923|Ga0207681_10003666 | All Organisms → cellular organisms → Bacteria | 9546 | Open in IMG/M |
3300025925|Ga0207650_10000006 | All Organisms → cellular organisms → Bacteria | 544730 | Open in IMG/M |
3300025925|Ga0207650_11114278 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300025926|Ga0207659_10421266 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300025926|Ga0207659_11761306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
3300025934|Ga0207686_10447890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 993 | Open in IMG/M |
3300025935|Ga0207709_10940165 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300025940|Ga0207691_11403769 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300025941|Ga0207711_10009328 | All Organisms → cellular organisms → Bacteria | 8192 | Open in IMG/M |
3300025941|Ga0207711_10025933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4916 | Open in IMG/M |
3300025941|Ga0207711_11288656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 673 | Open in IMG/M |
3300025942|Ga0207689_10529844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 988 | Open in IMG/M |
3300025945|Ga0207679_10611570 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300025960|Ga0207651_10900934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 788 | Open in IMG/M |
3300025960|Ga0207651_11588138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300025961|Ga0207712_10062526 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
3300025961|Ga0207712_10131388 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
3300026023|Ga0207677_11766138 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300026035|Ga0207703_12246772 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300026035|Ga0207703_12359120 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300026041|Ga0207639_11409068 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300026075|Ga0207708_10000790 | All Organisms → cellular organisms → Bacteria | 23866 | Open in IMG/M |
3300026088|Ga0207641_10125407 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300026088|Ga0207641_11564040 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300026089|Ga0207648_10097944 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
3300026089|Ga0207648_10406938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1234 | Open in IMG/M |
3300026095|Ga0207676_10089516 | All Organisms → cellular organisms → Bacteria | 2522 | Open in IMG/M |
3300026095|Ga0207676_11598605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
3300026095|Ga0207676_12075936 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026116|Ga0207674_10285461 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300026116|Ga0207674_10881596 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300026118|Ga0207675_101043602 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300026118|Ga0207675_102430326 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300026142|Ga0207698_10368179 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300027514|Ga0208338_1000014 | All Organisms → cellular organisms → Bacteria | 88299 | Open in IMG/M |
3300027637|Ga0209818_1000139 | All Organisms → cellular organisms → Bacteria | 16934 | Open in IMG/M |
3300027637|Ga0209818_1031681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1208 | Open in IMG/M |
3300027639|Ga0209387_1065178 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300027722|Ga0209819_10219717 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300027886|Ga0209486_10683127 | Not Available | 660 | Open in IMG/M |
3300027909|Ga0209382_10047840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5105 | Open in IMG/M |
3300027909|Ga0209382_11071613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 834 | Open in IMG/M |
3300028381|Ga0268264_10620302 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300028381|Ga0268264_10625672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
3300028381|Ga0268264_12483637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
3300030496|Ga0268240_10180332 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031548|Ga0307408_100122623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2016 | Open in IMG/M |
3300031548|Ga0307408_100501547 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300031716|Ga0310813_10510988 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300031731|Ga0307405_10110894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1858 | Open in IMG/M |
3300031852|Ga0307410_10597750 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300032002|Ga0307416_100851735 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300032002|Ga0307416_101510287 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300032157|Ga0315912_10016193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6177 | Open in IMG/M |
3300032174|Ga0307470_10244473 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 12.14% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.74% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.94% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.49% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001464 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 | Environmental | Open in IMG/M |
3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005238 | Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, Australia | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027514 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1019072332 | 3300000956 | Soil | MCPVCMTNVALVVAGATSGAGVLGYVAVKVRAMRRHRREPRTAQLASKKNKR* |
JGI12363J15224_1001684 | 3300001464 | Soil | MCPICMTNAVLVAAGATSGAGVLGFVAVKVRALRRYRREPRSAIGFKKE* |
JGI24806J26614_100000712 | 3300002090 | Soil | MCPLCMTNAALVVAGATSGAGVLGVVAVKVRALRRYRRDPLTTEKKEKKREAEQR* |
Ga0062593_1031405291 | 3300004114 | Soil | MCPICMTNAVLVAAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0062595_1005242672 | 3300004479 | Soil | MCPLCMTNAALVVAGATSGAGVLGFVAMKIRTLRRHRREPRPPQLDSKNSK* |
Ga0073692_10281101 | 3300005238 | Soil | MCPLCMTNVAVVVAGATSGAGMLGYVAVKVRALRRHRREPRTPQLDSKKNKQ* |
Ga0065704_100009886 | 3300005289 | Switchgrass Rhizosphere | MTNAALVVAGATSSAGMLGFVAVKVRALRRHRREPRTSQLDSKKSKQ* |
Ga0065712_100680352 | 3300005290 | Miscanthus Rhizosphere | MCPICMTNAVLVAAGATSGASVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0065712_101528932 | 3300005290 | Miscanthus Rhizosphere | MCPLCITNAVLLVAGATSGAGVLGLVTVKVRALRHHRREPRTAQLDAKKS |
Ga0065715_103883481 | 3300005293 | Miscanthus Rhizosphere | MCPLCITNAVLLVAGATSGAGVLGLVTVKVRALRHHRREPRTAQ |
Ga0065707_100888174 | 3300005295 | Switchgrass Rhizosphere | MCPICMTNAALVVAGATSSAGMLGFVAVKVRALRRHRREPRTSQLDSKKSKQ* |
Ga0065707_106851372 | 3300005295 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKIRALRRHRREPRKAQLDSKKSKQ* |
Ga0070670_10000009551 | 3300005331 | Switchgrass Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDPKKSKQ* |
Ga0066388_1026106762 | 3300005332 | Tropical Forest Soil | MCPICMTNVMLVVGGATSGAGVLGYVAVKVRALRRYRREARTAQLHSKKNKQ* |
Ga0070682_1000645341 | 3300005337 | Corn Rhizosphere | MCPICMTNAALVVAGATSSAGVLGFVAVKVRALRRHPREPRTAPLN |
Ga0070689_1000001445 | 3300005340 | Switchgrass Rhizosphere | MTNAVLVVAGAASSAGVAGFVAVKVRVLRRHRREPRTAQLDSNKSKQ* |
Ga0070689_1020973152 | 3300005340 | Switchgrass Rhizosphere | MTNAVLVAAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSNNER |
Ga0070687_1010803662 | 3300005343 | Switchgrass Rhizosphere | MCPICITNAAVVVAGATSGAGVLGYVAVKVRALRTRRREPRTAQPD |
Ga0070692_100511582 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGMLGFVAVKVRALRRHRRGPRRGQPETKKTKH* |
Ga0070669_1000090316 | 3300005353 | Switchgrass Rhizosphere | MCPICMTNAVLVVTGATSGAGVLGFVAVKVRALRRHRREPRTAQLESKKSK* |
Ga0070673_1013438282 | 3300005364 | Switchgrass Rhizosphere | MCPVCMTNAVVVVAGATSGVAVLSFVAVKVRAQRRHLRKPRTAQLDSTKSKQ* |
Ga0070673_1023865392 | 3300005364 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGLVAVKVRALRRYRRDPRTVQRDSNKSKQ* |
Ga0070673_1024046242 | 3300005364 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGAGSGAGVLGLVAVKVQALRRYRREPRATEKKEKK* |
Ga0070701_102474702 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRVLRRHRREPRTAQLDSNKSKQ* |
Ga0070700_1006603192 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPICMTNAVLVVTGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0070699_1000251738 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKH* |
Ga0070699_1000724732 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNVALVVAGSTSGAGVLGYVAVKIRALRRHRREPRTAPLDSKKNKQ* |
Ga0070684_1018645352 | 3300005535 | Corn Rhizosphere | MCPICMTNAALVVAGATSGAGALGFVAVKIRGLRRYRREPRPAKLESKKI |
Ga0068853_1014300752 | 3300005539 | Corn Rhizosphere | MCPICITNAAVVVAGATSGAGVLGYVAVKVRALRTRRREPRTAQPDSKKSKQ* |
Ga0070695_1011386741 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFMAVKVRTLRRHRREPRPAQLDSKKSKQ* |
Ga0070664_1006479052 | 3300005564 | Corn Rhizosphere | MCPVCMTNAVVVVAGATSGVGVLSFVAVKVRALRRHLRKPRTAQLDSTKSKQ* |
Ga0068857_1005866753 | 3300005577 | Corn Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRRRREPRTAQLDSKKSKQ* |
Ga0068857_1006103691 | 3300005577 | Corn Rhizosphere | MCPVCMTNAVVVVAGATSGVGVLSFVAVKVRALRRHLRKPRTAQLDSTKGKQ* |
Ga0068857_1007553651 | 3300005577 | Corn Rhizosphere | MCPICMTNAVLVVAGVTSGAGVLSFVAVKVRALRRHRREPRTAQLDPKKSKQ* |
Ga0068854_1013560141 | 3300005578 | Corn Rhizosphere | MCPICITNAAVVVAGATSGAGVLGYVAVKVRGLRTRRREPRTAQPDSKKSKQ* |
Ga0068852_1015735682 | 3300005616 | Corn Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0068859_1000058619 | 3300005617 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGLVAVKVRALRRHRREPRTVQRDSNKSKQ* |
Ga0068859_1000251962 | 3300005617 | Switchgrass Rhizosphere | MCPLCITNAVLLVAGATSGAGVLGLVTVKVRALRHHRREPRTAQLDAKKSK* |
Ga0068859_1001158772 | 3300005617 | Switchgrass Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRSLRRHRREPRTAQADSKKSKQ* |
Ga0068859_1002104723 | 3300005617 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGAGSGAGVLGLMAVKIRALRRDRREPRATEKKEKK* |
Ga0068859_1003244792 | 3300005617 | Switchgrass Rhizosphere | MCPICMTNAVLVAAGATSGAGVLSFVAVKVRALRRHRREPRTTKPDSKQSKQ* |
Ga0068864_1001903692 | 3300005618 | Switchgrass Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAQLDSKSKQ* |
Ga0068864_1018524472 | 3300005618 | Switchgrass Rhizosphere | MCPLCMTNAALIVAGAASGAGVVGFVAVKVRALRRHRRQPRTAQLDSKKSRQ* |
Ga0068861_1010207632 | 3300005719 | Switchgrass Rhizosphere | MCPLCMTNVALVVAGATSGAGVLSFVAVKVRTLRRHRREPRTAQLDSKKNKQ* |
Ga0068870_100389842 | 3300005840 | Miscanthus Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAQLDSNKSKQ* |
Ga0068870_106717282 | 3300005840 | Miscanthus Rhizosphere | MCPICMTNVVLAVAGVTSGAGVLGYATVKVRALRRHRREPRTAQQDSKKSKQ* |
Ga0068863_1001697832 | 3300005841 | Switchgrass Rhizosphere | MCPLCMTDVAIAVAGATSGAGVLSFVAVKIRALRRYRREPRTAQLESKKSKQ* |
Ga0068863_1001870092 | 3300005841 | Switchgrass Rhizosphere | MCPICMTNAALVVAGATSGASALGFVAVKVRTLRRHRRELRTAQPDSKKSKQ* |
Ga0068863_1021757812 | 3300005841 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRNLREPRTARRDSNKNKQ* |
Ga0068860_1005048422 | 3300005843 | Switchgrass Rhizosphere | MCPICMTNAVLVAAGATSGAGVLGFVAVKVRALRRHRREPRTAQ |
Ga0068862_1024539842 | 3300005844 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGTTSGAGVLGFVALKVRALRRHRREPRTPEPETKKTKQ* |
Ga0081539_100596063 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MMCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLNSKKNKQ* |
Ga0082029_11488492 | 3300006169 | Termite Nest | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQVDSKKSK* |
Ga0082029_12134813 | 3300006169 | Termite Nest | MCPLCMTNAALVVAGATSGAGVLGFLAVKVRALRRHRRKPRAMELDAKKSKQ* |
Ga0079222_104800092 | 3300006755 | Agricultural Soil | MCPICITNAAVVVAGATSGAGVLGFVAVKVRALRTRRREPRTAQPDSKKSKQ* |
Ga0075428_1010493022 | 3300006844 | Populus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGLVAVKVRALRRYRRDPLTTEKKEKKREAEQR* |
Ga0075428_1021156842 | 3300006844 | Populus Rhizosphere | MCPLCMTNAALVVAGATSGAGMLGFVAVKVRALRRHRREPRTPEPETKKTKQ* |
Ga0075421_1000597933 | 3300006845 | Populus Rhizosphere | MCPVCMTNAALVVAGATSGAGVLGLVAVKVRALRRHRREPRTAQPESKKTKQ* |
Ga0075433_102178602 | 3300006852 | Populus Rhizosphere | MCPLCITNAALVVAGVTSGAGVLGFVAAKVRALRRHRREPRTEQSQSRKTKQ* |
Ga0075433_103663561 | 3300006852 | Populus Rhizosphere | MCPICMTNVAVAVAGATSGAGVLSFVAVKMRTLRRHRREPIKAQTDSKKSKQ* |
Ga0075433_107081072 | 3300006852 | Populus Rhizosphere | MCPVCMTNAVVVVAGAASGAGVLGFVAVKVRALRWHLRKPRTAQLDSKKSKQ* |
Ga0075420_1000296493 | 3300006853 | Populus Rhizosphere | MCPVCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQPESKKTKQ* |
Ga0075425_1004226862 | 3300006854 | Populus Rhizosphere | MCPLCMTNVALVVAGATSGAGVVGYVAVKVRSLRRHRREPHTAQLNSKKNKQ* |
Ga0079217_100533252 | 3300006876 | Agricultural Soil | MCPICMTNAALVLAGATSGAGVLGLVAVKIRALRRHRREPRTAQLDSKKSKQ* |
Ga0079217_101353332 | 3300006876 | Agricultural Soil | MCPLCMTNAALVIAGATSGAGVLGFVAVKVRALRRRRHEPRTAQLDSKKSKQ* |
Ga0079217_110146062 | 3300006876 | Agricultural Soil | MCPLCMTNLVLVVGGATSGAGVLGYVAVKVRALRRHRREVRTAQL |
Ga0075429_1016292802 | 3300006880 | Populus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQPESKKTKQ* |
Ga0075424_1026229061 | 3300006904 | Populus Rhizosphere | MCPVCMTNAVVVVAGATSGAGVLGFVAVKVRALRRHLRKPRTAQ |
Ga0079216_102753932 | 3300006918 | Agricultural Soil | MCPICMTNAALVLVGATSGAGVLGLVAVKVRALRRHRREPRTAQQESKKSKQ* |
Ga0079218_108375412 | 3300007004 | Agricultural Soil | MCPFCMTNAALVVAGAASGAGVVSFVAVKVRALRRHRRNARTAQPDSKKSKQ* |
Ga0079218_112390342 | 3300007004 | Agricultural Soil | MCPICMTNAALVLAGATSGAGVLGLVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0079218_134702132 | 3300007004 | Agricultural Soil | MCPLCMTNVVLVVGGATSGVGVLGYVAVKVRALRRHRREARTPQLDSKKNKQ* |
Ga0105251_102646942 | 3300009011 | Switchgrass Rhizosphere | MTNVAVAVAGATSGAGVLGFVAVKIRALRRHKRKPRTAELDSKKSKQ* |
Ga0105247_108563752 | 3300009101 | Switchgrass Rhizosphere | MTDVAIAVAGATSGVGVLGFVAVKIRALRRYRREPRTAQLESKKSKQ* |
Ga0114129_113600362 | 3300009147 | Populus Rhizosphere | MCPICMTNVAVAVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLNSKKSK* |
Ga0114129_129665772 | 3300009147 | Populus Rhizosphere | MTNAALVVAGVTSGAGVVGFVAVKVRALRRHRREPRTAQLDSKKQGEKTWQSIS* |
Ga0105243_100147352 | 3300009148 | Miscanthus Rhizosphere | MCPLCMTNALVVVAGATSGAGVLGFVAVKVRALRQHRRESRTSQLDSKKSKQ* |
Ga0105243_103179702 | 3300009148 | Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRTLRRHRREPRPAQLDSKKSKQ* |
Ga0105243_114950922 | 3300009148 | Miscanthus Rhizosphere | MCPICMTNAVLVAAGATSGAGVLSFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0105243_124396292 | 3300009148 | Miscanthus Rhizosphere | MCPLCMTNAVLVVAGAASSAGVVGFVAVKVRTLRRHRREPRTA |
Ga0111538_116538822 | 3300009156 | Populus Rhizosphere | MTNAALVVAGASSSAGVLGLVAVKVRALRLHRREPRATEKKEKK* |
Ga0105092_101314732 | 3300009157 | Freshwater Sediment | MCPLCMTNVALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0075423_107724412 | 3300009162 | Populus Rhizosphere | MCPLCITNAALVVAGATSGAGVLGFVAAKVRALRRHRREPRTEQSESRKTKQ* |
Ga0075423_117458501 | 3300009162 | Populus Rhizosphere | MCPVCMTNAVVVVAGATSGAGVLGFVAVKVRALRRHLRKPRTAQLDSTKSKQ* |
Ga0075423_123136292 | 3300009162 | Populus Rhizosphere | MCPICMTNVAVALAGATSGAGVLSFVAVKMRTLRRHRREPIKAQTDSKKSKQ* |
Ga0105241_103529681 | 3300009174 | Corn Rhizosphere | MTNAVLVAAGATSGAGVLGFVAVKVRALRRHRRELRTAQLDSKKSKH* |
Ga0105241_105373092 | 3300009174 | Corn Rhizosphere | MCPLCMTNVALVVASSTSGAGVLGYVAVKIRALRRHRREPRTAPLDSKKNKQ* |
Ga0105241_108862312 | 3300009174 | Corn Rhizosphere | MTNVALVVAGATSGAGVLSFVAVKVRTLRRHRREPRTAQLDSKKNKQ* |
Ga0105241_115664742 | 3300009174 | Corn Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0105242_100163932 | 3300009176 | Miscanthus Rhizosphere | MTNALVVVAGATSGAGVLGFVAVKVRALRQHRRESRTSQLDSKKSKQ* |
Ga0105242_104991022 | 3300009176 | Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRTLRRHRREPRPAQLDSNKSKQ* |
Ga0105248_115842182 | 3300009177 | Switchgrass Rhizosphere | MCPICMTNAALVVAGATSGAGALGFVAVKIRGLRRYRREPRPAKLESKKINNK* |
Ga0105237_101629392 | 3300009545 | Corn Rhizosphere | MTNAVLVAAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0105238_112085111 | 3300009551 | Corn Rhizosphere | MCPICMTNAVLVVAGVTSGAGVLSFVAVKVRALRRHRREPRTTKPDSKQSK* |
Ga0105249_100022162 | 3300009553 | Switchgrass Rhizosphere | MTNAVLVVAGATSSAGVLGFVAVKVRALRRHRREPRTAQPDTKKSKQ* |
Ga0126307_103990572 | 3300009789 | Serpentine Soil | MCPLCMTNAALVVAGAASGAGVVGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0126313_106353372 | 3300009840 | Serpentine Soil | MANAALVVAGATSGAGVLGLVAVKVRALRRHRREPRTAQRDSNKSKQ* |
Ga0126315_100712232 | 3300010038 | Serpentine Soil | MCPLCITNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKNKL* |
Ga0126315_102379062 | 3300010038 | Serpentine Soil | MCPLCMTNAALVIASAASGAGVAGFVAVKVRALRRYRRKPRTGQLDSKKSKQ* |
Ga0126309_102481032 | 3300010039 | Serpentine Soil | MCPICMTNAALVVAGAASGAGVVGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0126312_103745432 | 3300010041 | Serpentine Soil | MCPLCMTNTALVVAGAASGAGVVGFVAVKVRALRRHRREPRTAQPDSKKSKQ* |
Ga0126312_106654792 | 3300010041 | Serpentine Soil | MCPLCMTNVVLVVAGATSGAGVLGYAAVKVRALRRHRREPRTAHPDSKKNKQ* |
Ga0126314_102084831 | 3300010042 | Serpentine Soil | MCPLCMANAALVVAGATSGAGVLGLVAVKVRALRRHRREPRTAQRDSNKSKQ* |
Ga0126314_104339752 | 3300010042 | Serpentine Soil | MCPLCMTNAALVVAGATSGAGVLGFVAVKIRALRRHRREPPTDSKKSKQ* |
Ga0126310_102133092 | 3300010044 | Serpentine Soil | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPPTDSKKSKQ* |
Ga0126310_110351622 | 3300010044 | Serpentine Soil | MCPLCMTNAALVVAGAASGAGVVGFVAVKVRALRRHRRKPRTAPLDSKKSKQ* |
Ga0126311_1000005019 | 3300010045 | Serpentine Soil | MCPICMINAVLVVAGATSGAGVLGLVAVKVRALRRHRREPRTAQRDSSKSKQ* |
Ga0126311_114565082 | 3300010045 | Serpentine Soil | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQRDSKKNKQ* |
Ga0126311_118400002 | 3300010045 | Serpentine Soil | LVVAGATSGAGVVGFVVVKVRALRRHRREPRKAQLDSKKSKQ* |
Ga0126384_115730102 | 3300010046 | Tropical Forest Soil | MCPVCMTNAALVVAGATSSAGALGFVAVKIRALRRHRREPHKVKLDSKKARS* |
Ga0126306_101154312 | 3300010166 | Serpentine Soil | MCPLCMTNAALVVAGAASGAGVVGFVAVKVRALRRHRRKPRTAQLDLKKSKQ* |
Ga0126376_114258642 | 3300010359 | Tropical Forest Soil | MCPICMTIAVLVASGATSCAGVLSFVAVKVRALRRHRREPRTAQ |
Ga0126376_115624042 | 3300010359 | Tropical Forest Soil | MCPVCMTNVVLAVAGATSGAGVVGFVAVKVRALRRHRREPRTAQPDSKKSKQ* |
Ga0126377_119384651 | 3300010362 | Tropical Forest Soil | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRRGPRTAQPDSKKNKE* |
Ga0134128_1001232212 | 3300010373 | Terrestrial Soil | MTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLESKKSK* |
Ga0134124_103500682 | 3300010397 | Terrestrial Soil | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRSLRRHRREPRTAQADMKKSKQ* |
Ga0134124_107699612 | 3300010397 | Terrestrial Soil | MCPVCMTNAALVVAGATSGAGALGFVAVKIRALRRYRREPRPLKLESKKNNNE* |
Ga0134124_116793212 | 3300010397 | Terrestrial Soil | MCPICMTNAALVVAGATSGAGALGFVAVKVRALRRYRREPRPAKLESKKINNK* |
Ga0134127_109120992 | 3300010399 | Terrestrial Soil | MCPLCMTNAVVVVAGATSGAGVLGFVAVKVRALRRHRRESRTSQLDSKKSKQ* |
Ga0134127_123373172 | 3300010399 | Terrestrial Soil | MCPICMTNVAVAVAGATSGAGVLGFVTLKVRALRRHRREPRIA |
Ga0134127_132793752 | 3300010399 | Terrestrial Soil | MTNAALVVAGATSGAGVLGYVAVKIRALRQQRREPRTAQLDSTKNKQ* |
Ga0134121_100014508 | 3300010401 | Terrestrial Soil | MTNAVLVVTGATSGAGVLGFVAVKVRALRRHRREPRTAQLESKKSK* |
Ga0134121_1000147513 | 3300010401 | Terrestrial Soil | MCPICMTNAVLVAAGATSGAGVLSFVAVKVRALRRDRREPRTAQLDSKKSKQ* |
Ga0105246_111218282 | 3300011119 | Miscanthus Rhizosphere | MTNVAVAVAGATSGAGVLGFVAVKIRSLRRHKRKPRTAELDSKKSKQ* |
Ga0105246_111876132 | 3300011119 | Miscanthus Rhizosphere | MCPMCMTNIALVAVGATSSAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0105246_116977101 | 3300011119 | Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKIRALRRHRREPRTAQLD |
Ga0120187_10006091 | 3300012015 | Terrestrial | MTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKK |
Ga0157378_104524882 | 3300013297 | Miscanthus Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAQLDSKKSKQ* |
Ga0157375_129042822 | 3300013308 | Miscanthus Rhizosphere | MCPLCMTNAALVVAGASSGAGVLGLVAVKVRALRRHRREPRATEKKEKK* |
Ga0120195_10000472 | 3300013500 | Terrestrial | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQPELKKSKQ* |
Ga0163163_1000002674 | 3300014325 | Switchgrass Rhizosphere | MTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDPKKSKQ* |
Ga0163163_127105262 | 3300014325 | Switchgrass Rhizosphere | MTNAALVVAGAGSGAGVLGLMAVKVRALRRDRREPRATEKKEKK* |
Ga0157380_105533132 | 3300014326 | Switchgrass Rhizosphere | MCPVCMTNVAVAVAGATSGAGVLGFVAMKVRALRRHLRKPRTAQLDSKKSKQ* |
Ga0157377_100599682 | 3300014745 | Miscanthus Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRRTAQPDSKKSKQ* |
Ga0157377_106574852 | 3300014745 | Miscanthus Rhizosphere | MCPICMTNAALVVAAATAGAGALGFVAVKVRTLRRHRREPRTAQP |
Ga0157379_107016181 | 3300014968 | Switchgrass Rhizosphere | AVLLVAGATSGAGVLGLVTVKVRALRHHRREPRTAQLDAKKSK* |
Ga0132258_125239032 | 3300015371 | Arabidopsis Rhizosphere | MTDVAIAVAGATSGAGVLGFVAVKIRALRRYRREPRTAQLESKKSKQ* |
Ga0132255_1018455782 | 3300015374 | Arabidopsis Rhizosphere | MCPLCMTDVAIAVAGATSGTGVLSFVAVKIRALRRYRREPRTAQLESKKSKQ* |
Ga0190268_121572682 | 3300018466 | Soil | MCPLCMTNVVLVVGGAASGAGVLGYVAVKVRALRRYRREPRTVQLDSKKNKQ |
Ga0190274_103267302 | 3300018476 | Soil | MCPLCMTNVVLVVAGATSGAGVLGYVAVKARALRRYRREPRTAQLDSKKNKQ |
Ga0190274_106799022 | 3300018476 | Soil | MCPLCMTNAALIVAGATSSAGVLGFVAVRVRALRRHRREPRTAQLDSKKSKQ |
Ga0190264_114073012 | 3300019377 | Soil | MCPLCMTNAALVVAGAASGAGVVGFVAVKVRALRRRRREPRTAQLDSKKSKQ |
Ga0207713_11802581 | 3300025735 | Switchgrass Rhizosphere | MCPVCMTNVAVAVAGATSGAGVLGFVAVKIRSLRRHKRKPRTAELDSKKSKQ |
Ga0207710_102044572 | 3300025900 | Switchgrass Rhizosphere | MCPICMTNAVLVAAGATSGAGVLSFVAVKVRALRRHRREPRTTKPDSKQSKQ |
Ga0207710_105975952 | 3300025900 | Switchgrass Rhizosphere | MCPVCMTNVAVAVAGATSGAGVLGFVAVKIRALRRHKRKPRTAELDSKKSKQ |
Ga0207645_108865652 | 3300025907 | Miscanthus Rhizosphere | MCPICITNAAVVVAGATSGAGVLGFVAVKVRALRTRRREPRTAQPDSKSKQ |
Ga0207643_100755682 | 3300025908 | Miscanthus Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAQLDSNKSKQ |
Ga0207643_110410861 | 3300025908 | Miscanthus Rhizosphere | MCPICMTNVVLAVAGVTSGAGVLGYATVKVRALRRHRREPRTAQQDSKKSKQ |
Ga0207660_109617702 | 3300025917 | Corn Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKIRTLRRHRREPRTAQLDSKKSKQ |
Ga0207652_100294882 | 3300025921 | Corn Rhizosphere | MCPLCMTNVALVVAGSTSGAGVLGYVAVKIRALRRHRREPRTAPLDSKKNKQ |
Ga0207646_100564744 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPVCMTNVALVVAGSTSSAGVLGYVAVKIRALRRHRREPRTAPLDSKKNKQ |
Ga0207681_100036668 | 3300025923 | Switchgrass Rhizosphere | MCPICMTNAVLVVTGATSGAGVLGFVAVKVRALRRHRREPRTAQLESKKSK |
Ga0207650_1000000678 | 3300025925 | Switchgrass Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDPKKSKQ |
Ga0207650_111142782 | 3300025925 | Switchgrass Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAPLDSKKTKQ |
Ga0207659_104212662 | 3300025926 | Miscanthus Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRSLRRHRREPRTAQADMKKSKQ |
Ga0207659_117613062 | 3300025926 | Miscanthus Rhizosphere | MCPICITNAAVVVAGATSGAGVLGFVAVKVRALRTRRREPRTAQPDSKKSKQ |
Ga0207686_104478902 | 3300025934 | Miscanthus Rhizosphere | MCPLCMTNALVVVAGATSGAGVLGFVAVKVRALRQHRRESRTSQLDSKKSKQ |
Ga0207709_109401652 | 3300025935 | Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRTLRRHRREPRPAQLDSKKSKQ |
Ga0207691_114037692 | 3300025940 | Miscanthus Rhizosphere | MCPVCMTNAVVVVAGATSGAGVLGYAAVKVRALRRHRREPRTAQPDSKKNKQ |
Ga0207711_100093282 | 3300025941 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGLVAVKVRALRRHRREPRTVQRDSNKSKQ |
Ga0207711_100259334 | 3300025941 | Switchgrass Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRSLRRHRREPRTAQADSKKSKQ |
Ga0207711_112886562 | 3300025941 | Switchgrass Rhizosphere | MCPVCMTNAVVVVAGATSGVGVLSFVAVKVRALRRHLRKPRTAQLDSTKGKQ |
Ga0207689_105298442 | 3300025942 | Miscanthus Rhizosphere | MCPVCMTNVAVAVAGATSGAGVLGFVAMKVRALRRHLRKPRTAQLDSTKSKQ |
Ga0207679_106115702 | 3300025945 | Corn Rhizosphere | MCPVCMTNAVVVVAGATSGVGVLSFVAVKVRALRRHLRKPRTAQLDSTKSKQ |
Ga0207651_109009341 | 3300025960 | Switchgrass Rhizosphere | MTNAALVVAGAGSGAGVLGLVAVKVRALRRHRREPRATDKKEKK |
Ga0207651_115881382 | 3300025960 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGLVAVKVRALRRYRRDPRTVQRDSNKSKQ |
Ga0207712_100625261 | 3300025961 | Switchgrass Rhizosphere | NQLASTVTTVRNQEGELITMCPICMTNAVLVVAGATSSAGVLGFVAVKVRALRRHRREPRTAQPDTKKSKQ |
Ga0207712_101313882 | 3300025961 | Switchgrass Rhizosphere | MCPICMTNAALVVAGATSSAGMLGFVAVKVRALRRHRREPRTSQLDSKKSKQ |
Ga0207677_117661381 | 3300026023 | Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRNLREPRTARRDSNKSKQ |
Ga0207703_122467721 | 3300026035 | Switchgrass Rhizosphere | MCPLCITNAVLLVAGATSGAGVLGLVTVKVRALRHHRREPRTAQLDAKKSK |
Ga0207703_123591202 | 3300026035 | Switchgrass Rhizosphere | MCPLCMTNAVVMVAGATSGAGVLGFLAVKVRALRRHRRTPPTAQLDSKKSKQ |
Ga0207639_114090682 | 3300026041 | Corn Rhizosphere | MCPICITNAAVVVAGATSGAGVLGYVAVKVRALRTRRREPRTAQPDSKKSKQ |
Ga0207708_100007904 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPLCMTNAALVVAGATSSAGVLGLVAVKVRALRRHRREPRTVQRDSNKSKQ |
Ga0207641_101254072 | 3300026088 | Switchgrass Rhizosphere | MCPICMTNAALVVAGATSGASALGFVAVKVRTLRRHRRELRTAQPDSKKSKQ |
Ga0207641_115640401 | 3300026088 | Switchgrass Rhizosphere | MCPLCMTNAALIVAGAASGAGMVGFVAVKVRALRRHRRKPRTAQLDSKKSRQ |
Ga0207648_100979443 | 3300026089 | Miscanthus Rhizosphere | MCPLCMTNAVLVVAGAASSAGVVGFVAVRVRTLRRHRREPRTAQLDSKKSKQ |
Ga0207648_104069382 | 3300026089 | Miscanthus Rhizosphere | MCPICMTNAVLVVAGATSSAGVLGFVAVKVRALRRHRREPRTAQPDTKKSKQ |
Ga0207676_100895162 | 3300026095 | Switchgrass Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAQLDSKSKQ |
Ga0207676_115986052 | 3300026095 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGAGSGAGVLGLVAVKVQALRRYRREPRATEKKEKK |
Ga0207676_120759362 | 3300026095 | Switchgrass Rhizosphere | MCPLCMTNAALVVAGATSSAGVLGFVAVKVRALRRHRREPGTAQRDSKKSKQ |
Ga0207674_102854612 | 3300026116 | Corn Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRRRREPRTAQLDSKKSKQ |
Ga0207674_108815962 | 3300026116 | Corn Rhizosphere | MCPVCMTNAALVVAGASSGAGVLGLVAVKVRALRRHRREPRATEKKEKK |
Ga0207675_1010436022 | 3300026118 | Switchgrass Rhizosphere | MCPLCMTNVALVVAGATSGAGVLSFVAVKVRTLRRHRREPRTAQLDSKKNKQ |
Ga0207675_1024303261 | 3300026118 | Switchgrass Rhizosphere | MCPLCMTNAVLVVAGAASSAGVAGFVAVKVRALRRHRREPRTAQLDSKKSKQ |
Ga0207698_103681792 | 3300026142 | Corn Rhizosphere | MCPICMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQL |
Ga0208338_100001413 | 3300027514 | Soil | MCPICMTNAVLVAAGATSGAGVLGFVAVKVRALRRYRREPRSAIGFKKE |
Ga0209818_100013917 | 3300027637 | Agricultural Soil | MCPICMTNAALVLVGATSGAGVLGLVAVKVRALRRHRREPRTAQQESKKSKQ |
Ga0209818_10316812 | 3300027637 | Agricultural Soil | MCPLCMTNAALVIAGATSGAGVLGFVAVKVRALRRRRHEPRTAQLDSKKSKQ |
Ga0209387_10651782 | 3300027639 | Agricultural Soil | MCPICMTNAALVLAGATSGAGVLGLVAVKIRALRRHRREPRTAQLDSKKSKQ |
Ga0209819_102197172 | 3300027722 | Freshwater Sediment | MCPLCMTNVALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ |
Ga0209486_106831271 | 3300027886 | Agricultural Soil | MCPLCMTNVVLVVGGATSGVGVLGYVAVKVRALRRHRREARTPQLDSKKNKQ |
Ga0209382_100478404 | 3300027909 | Populus Rhizosphere | MCPVCMTNAALVVAGATSGAGVLGLVAVKVRALRRHRREPRTAQPESKKTKQ |
Ga0209382_110716132 | 3300027909 | Populus Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGLVAVKVRALRRYRRDPLTTEKKEKKREAEQR |
Ga0268264_106203022 | 3300028381 | Switchgrass Rhizosphere | MCPLCMTNAVVMVAGATSGAGVLGFLAVKVRALRRHRRTPRTAQLDSKKSKQ |
Ga0268264_106256722 | 3300028381 | Switchgrass Rhizosphere | MCPICMTNAVLVAAGATSGAGVLGFVAVKVRALRRHRREPRTAQLDSKKSKQ |
Ga0268264_124836371 | 3300028381 | Switchgrass Rhizosphere | VTTVRNQEGESITMCPICMTNAMLVVAGATSSAGVLGFVAVKVRALRRHRRTAQPDMKKSKQ |
Ga0268240_101803321 | 3300030496 | Soil | MCPLCMTNAALVVAGATSGAGVLSLVAVKVRALRRHRREPRSTEKKEKA |
Ga0307408_1001226232 | 3300031548 | Rhizosphere | MCPICMTNAALVVAGATSGAGVLGLVAVKVRALRRQRREPRTAQLDSKRSKQ |
Ga0307408_1005015472 | 3300031548 | Rhizosphere | MCPLCMTNAALVIAGATSGAGVLGLVAVKVRALRRHRREPRTTEKKEKA |
Ga0310813_105109881 | 3300031716 | Soil | MCPICMTNVVLVVAGTTSGAGVLGFVAVKVRALRRPRREPQRVQLDI |
Ga0307405_101108942 | 3300031731 | Rhizosphere | MCPICMTNAALVVVGATSGAGVLGFVAVKVRALRRQRREPRTAQLDSKRSKQ |
Ga0307410_105977502 | 3300031852 | Rhizosphere | MCPICMTNAALVVAGATSGAGVLGLVAVKVRALRRQRRDPRTAQLDSKRSKQ |
Ga0307416_1008517351 | 3300032002 | Rhizosphere | MCPMCMTNAVLVVAGATSGAGVVGYVAVKVRALRRHRREPHTAQLDTKKTKQ |
Ga0307416_1015102872 | 3300032002 | Rhizosphere | MCPLCMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQPESK |
Ga0315912_100161935 | 3300032157 | Soil | MCPICMTNAALVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQRESKKIKQ |
Ga0307470_102444732 | 3300032174 | Hardwood Forest Soil | MCPLCMTNAVLVVAGATSGAGVLGFVAVKVRALRRHRREPRTAQPESKKTKQ |
⦗Top⦘ |