NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209049_1000188

Scaffold Ga0209049_1000188


Overview

Basic Information
Taxon OID3300027404 Open in IMG/M
Scaffold IDGa0209049_1000188 Open in IMG/M
Source Dataset NameMarine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13376
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameGermany: Marburg
CoordinatesLat. (o)50.8Long. (o)8.81Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039940Metagenome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0209049_10001889F039940GGAMVGDCYTQSVMMSDLSIAVTPRLGFLTPPLYSLLGQQA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.