Metagenome Family F039940

Basic Information
Family ID	F039940
Family Type	Metagenome
Number of Sequences	162
Average Sequence Length	46 residues
Representative Sequence	AFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA
Number of Associated Samples	10
Number of Associated Scaffolds	160

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	14.81 %
% of genes near scaffold ends (potentially truncated)	60.49 %
% of genes from short scaffolds (< 2000 bps)	17.90 %
Associated GOLD sequencing projects	6
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Bacteria (89.506 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (95.062 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 160 Family Scaffolds
PF10576	EndIII_4Fe-2S	1.88
PF05685	Uma2	1.88
PF00578	AhpC-TSA	1.25
PF02955	GSH-S_ATP	1.25
PF04715	Anth_synt_I_N	1.25
PF00381	PTS-HPr	1.25
PF03143	GTP_EFTU_D3	1.25
PF13683	rve_3	1.25
PF04205	FMN_bind	1.25
PF02508	Rnf-Nqr	1.25
PF16576	HlyD_D23	1.25
PF00654	Voltage_CLC	1.25
PF13614	AAA_31	1.25
PF02604	PhdYeFM_antitox	1.25
PF00665	rve	1.25
PF03739	LptF_LptG	1.25
PF00248	Aldo_ket_red	1.25
PF03966	Trm112p	1.25
PF01925	TauE	0.62
PF02627	CMD	0.62
PF03308	MeaB	0.62
PF02283	CobU	0.62
PF01050	MannoseP_isomer	0.62
PF02374	ArsA_ATPase	0.62
PF03461	TRCF	0.62
PF13439	Glyco_transf_4	0.62
PF04995	CcmD	0.62
PF08502	LeuA_dimer	0.62
PF13604	AAA_30	0.62
PF12770	CHAT	0.62
PF00128	Alpha-amylase	0.62
PF01850	PIN	0.62
PF02272	DHHA1	0.62
PF02803	Thiolase_C	0.62
PF03477	ATP-cone	0.62
PF00338	Ribosomal_S10	0.62
PF03706	LPG_synthase_TM	0.62
PF03100	CcmE	0.62
PF13358	DDE_3	0.62
PF12760	Zn_Tnp_IS1595	0.62
PF02629	CoA_binding	0.62
PF02518	HATPase_c	0.62
PF00698	Acyl_transf_1	0.62
PF02817	E3_binding	0.62
PF02912	Phe_tRNA-synt_N	0.62
PF02873	MurB_C	0.62
PF01797	Y1_Tnp	0.62
PF01370	Epimerase	0.62
PF00112	Peptidase_C1	0.62
PF04143	Sulf_transp	0.62
PF00216	Bac_DNA_binding	0.62
PF01351	RNase_HII	0.62
PF02729	OTCace_N	0.62
PF11939	NiFe-hyd_HybE	0.62
PF10276	zf-CHCC	0.62
PF04055	Radical_SAM	0.62
PF13579	Glyco_trans_4_4	0.62
PF01656	CbiA	0.62
PF00027	cNMP_binding	0.62
PF01040	UbiA	0.62
PF13090	PP_kinase_C	0.62
PF00271	Helicase_C	0.62
PF11845	DUF3365	0.62
PF13975	gag-asp_proteas	0.62
PF14821	Thr_synth_N	0.62
PF01887	SAM_HAT_N	0.62
PF17042	NBD_C	0.62
PF03372	Exo_endo_phos	0.62
PF01921	tRNA-synt_1f	0.62
PF07973	tRNA_SAD	0.62
PF13384	HTH_23	0.62
PF00437	T2SSE	0.62
PF01903	CbiX	0.62
PF01855	POR_N	0.62
PF02899	Phage_int_SAM_1	0.62
PF00300	His_Phos_1	0.62
PF00226	DnaJ	0.62
PF00072	Response_reg	0.62
PF01882	DUF58	0.62
PF04365	BrnT_toxin	0.62
PF16320	Ribosomal_L12_N	0.62
PF12627	PolyA_pol_RNAbd	0.62
PF08264	Anticodon_1	0.62
PF02446	Glyco_hydro_77	0.62
PF06968	BATS	0.62
PF02548	Pantoate_transf	0.62
PF00310	GATase_2	0.62
PF00117	GATase	0.62
PF00573	Ribosomal_L4	0.62
PF08442	ATP-grasp_2	0.62
PF13361	UvrD_C	0.62
PF01408	GFO_IDH_MocA	0.62
PF01381	HTH_3	0.62
PF13187	Fer4_9	0.62
PF13304	AAA_21	0.62
PF07478	Dala_Dala_lig_C	0.62
PF01208	URO-D	0.62
PF13424	TPR_12	0.62
PF08478	POTRA_1	0.62
PF07883	Cupin_2	0.62
PF00483	NTP_transferase	0.62
PF00977	His_biosynth	0.62
PF00106	adh_short	0.62
PF14491	DUF4435	0.62
PF05524	PEP-utilisers_N	0.62
PF13635	DUF4143	0.62
PF00534	Glycos_transf_1	0.62
PF00816	Histone_HNS	0.62
PF05598	DUF772	0.62
PF15919	HicB_lk_antitox	0.62
PF00152	tRNA-synt_2	0.62
PF01609	DDE_Tnp_1	0.62
PF14384	BrnA_antitoxin	0.62
PF01300	Sua5_yciO_yrdC	0.62
PF07788	PDDEXK_10	0.62
PF13744	HTH_37	0.62
PF06594	HCBP_related	0.62
PF03548	LolA	0.62
PF01578	Cytochrom_C_asm	0.62
PF00664	ABC_membrane	0.62
PF11159	DUF2939	0.62
PF00268	Ribonuc_red_sm	0.62
PF08534	Redoxin	0.62
PF03951	Gln-synt_N	0.62
PF04186	FxsA	0.62
PF01583	APS_kinase	0.62
PF08328	ASL_C	0.62

COG ID	Name	Functional Category	% Frequency in 160 Family Scaffolds
COG0189	Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily	Translation, ribosomal structure and biogenesis [J]	2.50
COG0147	Anthranilate/para-aminobenzoate synthases component I	Amino acid transport and metabolism [E]	2.50
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	1.88
COG1925	HPr or related phosphotransfer protein	Signal transduction mechanisms [T]	1.25
COG0795	Lipopolysaccharide export LptBFGC system, permease protein LptF	Cell wall/membrane/envelope biogenesis [M]	1.25
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	1.25
COG0458	Carbamoylphosphate synthase large subunit	Amino acid transport and metabolism [E]	1.25
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	1.25
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	1.25
COG1197	Transcription-repair coupling factor (superfamily II helicase)	Transcription [K]	1.25
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	1.25
COG1347	Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrD	Energy production and conversion [C]	1.25
COG4584	Transposase	Mobilome: prophages, transposons [X]	1.25
COG4657	Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfA subunit	Energy production and conversion [C]	1.25
COG4660	Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfE subunit	Energy production and conversion [C]	1.25
COG2209	Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE	Energy production and conversion [C]	1.25
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	1.25
COG0038	H+/Cl- antiporter ClcA	Inorganic ion transport and metabolism [P]	1.25
COG2269	Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)	Translation, ribosomal structure and biogenesis [J]	0.62
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.62
COG2332	Cytochrome c biogenesis protein CcmE	Posttranslational modification, protein turnover, chaperones [O]	0.62
COG2391	Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains	General function prediction only [R]	0.62
COG2087	Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase	Coenzyme transport and metabolism [H]	0.62
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.62
COG3114	Heme exporter protein D	Intracellular trafficking, secretion, and vesicular transport [U]	0.62
COG2834	Outer membrane lipoprotein-sorting protein	Cell wall/membrane/envelope biogenesis [M]	0.62
COG2916	DNA-binding protein H-NS	Transcription [K]	0.62
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.62
COG2931	Ca2+-binding protein, RTX toxin-related	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.62
COG3030	FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family	General function prediction only [R]	0.62
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.62
COG1589	Cell division septal protein FtsQ	Cell cycle control, cell division, chromosome partitioning [D]	0.62
COG3280	Maltooligosyltrehalose synthase	Carbohydrate transport and metabolism [G]	0.62
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.62
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.62
COG4231	TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.62
COG4775	Outer membrane protein assembly factor BamA	Cell wall/membrane/envelope biogenesis [M]	0.62
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	0.62
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	0.62
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.62
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.62
COG5493	Uncharacterized protein, contains PD-(D/E)XK nuclease domain	General function prediction only [R]	0.62
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.62
COG0151	Phosphoribosylamine-glycine ligase	Nucleotide transport and metabolism [F]	0.62
COG0392	Predicted membrane flippase AglD2/YbhN, UPF0104 family	Cell wall/membrane/envelope biogenesis [M]	0.62
COG0366	Glycosidase/amylase (phosphorylase)	Carbohydrate transport and metabolism [G]	0.62
COG0296	1,4-alpha-glucan branching enzyme	Carbohydrate transport and metabolism [G]	0.62
COG0208	Ribonucleotide reductase beta subunit, ferritin-like domain	Nucleotide transport and metabolism [F]	0.62
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	0.62
COG0174	Glutamine synthetase	Amino acid transport and metabolism [E]	0.62
COG0173	Aspartyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.62
COG0164	Ribonuclease HII	Replication, recombination and repair [L]	0.62
COG0407	Uroporphyrinogen-III decarboxylase HemE	Coenzyme transport and metabolism [H]	0.62
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	0.62
COG0088	Ribosomal protein L4	Translation, ribosomal structure and biogenesis [J]	0.62
COG0051	Ribosomal protein S10	Translation, ribosomal structure and biogenesis [J]	0.62
COG0045	Succinyl-CoA synthetase, beta subunit	Energy production and conversion [C]	0.62
COG0026	Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)	Nucleotide transport and metabolism [F]	0.62
COG0017	Aspartyl/asparaginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.62
COG0016	Phenylalanyl-tRNA synthetase alpha subunit	Translation, ribosomal structure and biogenesis [J]	0.62
COG0812	UDP-N-acetylenolpyruvoylglucosamine reductase	Cell wall/membrane/envelope biogenesis [M]	0.62
COG1721	Uncharacterized conserved protein, DUF58 family, contains vWF domain	Function unknown [S]	0.62
COG1640	4-alpha-glucanotransferase	Carbohydrate transport and metabolism [G]	0.62
COG0015	Adenylosuccinate lyase	Nucleotide transport and metabolism [F]	0.62
COG1523	Pullulanase/glycogen debranching enzyme	Carbohydrate transport and metabolism [G]	0.62
COG1384	Lysyl-tRNA synthetase, class I	Translation, ribosomal structure and biogenesis [J]	0.62
COG1190	Lysyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.62
COG1042	Acyl-CoA synthetase (NDP forming)	Energy production and conversion [C]	0.62
COG1039	Ribonuclease HIII	Replication, recombination and repair [L]	0.62
COG1912	Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)	Defense mechanisms [V]	0.62
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.62
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.62
COG0674	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.62
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.62
COG0529	Adenylylsulfate kinase or related kinase	Inorganic ion transport and metabolism [P]	0.62
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	0.62
COG0413	Ketopantoate hydroxymethyltransferase	Coenzyme transport and metabolism [H]	0.62

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.74 %
Unclassified	root	N/A	9.26 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.12 %
Unclassified	root	N/A	9.26 %
Viruses	superkingdom	All Organisms → Viruses	0.62 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.51 %
Unclassified	root	N/A	9.26 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.62 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	82.72 %
Unclassified	root	N/A	9.26 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	69.14 %
Unclassified	root	N/A	9.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.62 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	44.44 %
Unclassified	root	N/A	9.26 %
Gammaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis	0.62 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.62 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	40.74 %
Unclassified	root	N/A	9.26 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.62 %
Candidatus Competibacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae	0.62 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Candidatus Thiosymbion	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion	2.47 %
Lamprocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis	2.47 %
Thioflavicoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Candidatus Contendobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Thiorhodococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus	0.62 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.26 %
Lamprocystis purpurea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	2.47 %
Candidatus Thiosymbion oneisti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	2.47 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.62 %
Thiorhodococcus drewsii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	0.62 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.62 %
Thioflavicoccus mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	0.62 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.62 %
Thiocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	0.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003851\|Ga0049111_1000017	All Organisms → cellular organisms → Bacteria → Proteobacteria	12276	Open in IMG/M
3300003851\|Ga0049111_1000044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	9390	Open in IMG/M
3300003851\|Ga0049111_1000090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7685	Open in IMG/M
3300003851\|Ga0049111_1000160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	6133	Open in IMG/M
3300003851\|Ga0049111_1000271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	4717	Open in IMG/M
3300003851\|Ga0049111_1000505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	3254	Open in IMG/M
3300003851\|Ga0049111_1000600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis	2976	Open in IMG/M
3300003851\|Ga0049111_1000677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2776	Open in IMG/M
3300003851\|Ga0049111_1000819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2470	Open in IMG/M
3300003851\|Ga0049111_1001100	All Organisms → cellular organisms → Bacteria → Proteobacteria	2067	Open in IMG/M
3300003851\|Ga0049111_1001248	Not Available	1873	Open in IMG/M
3300003851\|Ga0049111_1001289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	1830	Open in IMG/M
3300003851\|Ga0049111_1001679	Not Available	1536	Open in IMG/M
3300003855\|Ga0049112_1000113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	10981	Open in IMG/M
3300003855\|Ga0049112_1000201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	8458	Open in IMG/M
3300003855\|Ga0049112_1000232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7847	Open in IMG/M
3300003855\|Ga0049112_1000299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	6765	Open in IMG/M
3300003855\|Ga0049112_1000457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	5396	Open in IMG/M
3300003855\|Ga0049112_1000647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	4311	Open in IMG/M
3300003855\|Ga0049112_1000806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3633	Open in IMG/M
3300003855\|Ga0049112_1000993	Not Available	3167	Open in IMG/M
3300003855\|Ga0049112_1001144	All Organisms → cellular organisms → Bacteria → Proteobacteria	2814	Open in IMG/M
3300003855\|Ga0049112_1001162	Not Available	2786	Open in IMG/M
3300003855\|Ga0049112_1001377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2470	Open in IMG/M
3300003855\|Ga0049112_1001458	All Organisms → cellular organisms → Bacteria → Proteobacteria	2354	Open in IMG/M
3300003855\|Ga0049112_1001544	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	2270	Open in IMG/M
3300003855\|Ga0049112_1007099	Not Available	894	Open in IMG/M
3300003855\|Ga0049112_1011222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	743	Open in IMG/M
3300003855\|Ga0049112_1022674	Not Available	588	Open in IMG/M
3300003906\|JGI26667J51740_10000089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	9167	Open in IMG/M
3300003906\|JGI26667J51740_10000090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	9135	Open in IMG/M
3300003906\|JGI26667J51740_10000182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7200	Open in IMG/M
3300003906\|JGI26667J51740_10000296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	5990	Open in IMG/M
3300003906\|JGI26667J51740_10000308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	5905	Open in IMG/M
3300003906\|JGI26667J51740_10000332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	5700	Open in IMG/M
3300003906\|JGI26667J51740_10000441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	5034	Open in IMG/M
3300003906\|JGI26667J51740_10000793	All Organisms → cellular organisms → Bacteria → Proteobacteria	3853	Open in IMG/M
3300003906\|JGI26667J51740_10002175	All Organisms → cellular organisms → Bacteria → Proteobacteria	2378	Open in IMG/M
3300003906\|JGI26667J51740_10002790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	2153	Open in IMG/M
3300003906\|JGI26667J51740_10013259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1359	Open in IMG/M
3300004630\|Ga0049105_1002052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	9656	Open in IMG/M
3300004630\|Ga0049105_1002218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	9442	Open in IMG/M
3300004630\|Ga0049105_1004382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7821	Open in IMG/M
3300004630\|Ga0049105_1005482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7303	Open in IMG/M
3300004630\|Ga0049105_1006137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7039	Open in IMG/M
3300004630\|Ga0049105_1008114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6453	Open in IMG/M
3300004630\|Ga0049105_1010045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	6018	Open in IMG/M
3300004630\|Ga0049105_1010909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	5858	Open in IMG/M
3300004630\|Ga0049105_1011193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5804	Open in IMG/M
3300004630\|Ga0049105_1016076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	5081	Open in IMG/M
3300004630\|Ga0049105_1028065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	4044	Open in IMG/M
3300004630\|Ga0049105_1032040	All Organisms → cellular organisms → Bacteria → Proteobacteria	3813	Open in IMG/M
3300004630\|Ga0049105_1035901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	3620	Open in IMG/M
3300004630\|Ga0049105_1042340	Not Available	3344	Open in IMG/M
3300004630\|Ga0049105_1047989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3138	Open in IMG/M
3300004630\|Ga0049105_1048519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	3122	Open in IMG/M
3300004630\|Ga0049105_1064592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2675	Open in IMG/M
3300004630\|Ga0049105_1078267	All Organisms → cellular organisms → Bacteria → Proteobacteria	2390	Open in IMG/M
3300004630\|Ga0049105_1091920	All Organisms → cellular organisms → Bacteria	2159	Open in IMG/M
3300004630\|Ga0049105_1098860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2056	Open in IMG/M
3300004630\|Ga0049105_1162278	All Organisms → cellular organisms → Bacteria	1395	Open in IMG/M
3300004630\|Ga0049105_1162310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	1395	Open in IMG/M
3300004630\|Ga0049105_1175939	All Organisms → cellular organisms → Bacteria	1295	Open in IMG/M
3300004630\|Ga0049105_1198817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	1148	Open in IMG/M
3300004630\|Ga0049105_1227292	Not Available	994	Open in IMG/M
3300004630\|Ga0049105_1305275	Not Available	691	Open in IMG/M
3300005170\|Ga0071327_1001429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	9671	Open in IMG/M
3300005170\|Ga0071327_1057371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2675	Open in IMG/M
3300005170\|Ga0071327_1157445	Not Available	1351	Open in IMG/M
3300008214\|Ga0056111_1001031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	4062	Open in IMG/M
3300008214\|Ga0056111_1001154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3781	Open in IMG/M
3300008214\|Ga0056111_1002185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2247	Open in IMG/M
3300008214\|Ga0056111_1002290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2155	Open in IMG/M
3300008214\|Ga0056111_1002517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	1978	Open in IMG/M
3300008214\|Ga0056111_1002955	Not Available	1715	Open in IMG/M
3300008214\|Ga0056111_1006878	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300008214\|Ga0056111_1009520	Not Available	767	Open in IMG/M
3300027341\|Ga0209453_1000007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	26056	Open in IMG/M
3300027341\|Ga0209453_1000045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	14636	Open in IMG/M
3300027341\|Ga0209453_1000049	All Organisms → cellular organisms → Bacteria	14458	Open in IMG/M
3300027341\|Ga0209453_1000059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	13355	Open in IMG/M
3300027341\|Ga0209453_1000060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	13282	Open in IMG/M
3300027341\|Ga0209453_1000060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	13282	Open in IMG/M
3300027341\|Ga0209453_1000075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	11581	Open in IMG/M
3300027341\|Ga0209453_1000076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	11574	Open in IMG/M
3300027341\|Ga0209453_1000086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	10713	Open in IMG/M
3300027341\|Ga0209453_1000095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	9821	Open in IMG/M
3300027341\|Ga0209453_1000100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	9686	Open in IMG/M
3300027341\|Ga0209453_1000125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	8601	Open in IMG/M
3300027341\|Ga0209453_1000136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	8142	Open in IMG/M
3300027341\|Ga0209453_1000137	All Organisms → cellular organisms → Bacteria → Proteobacteria	8087	Open in IMG/M
3300027341\|Ga0209453_1000144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7949	Open in IMG/M
3300027341\|Ga0209453_1000159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7374	Open in IMG/M
3300027341\|Ga0209453_1000159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7374	Open in IMG/M
3300027341\|Ga0209453_1000170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7192	Open in IMG/M
3300027341\|Ga0209453_1000179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7024	Open in IMG/M
3300027341\|Ga0209453_1000183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6850	Open in IMG/M
3300027341\|Ga0209453_1000191	All Organisms → cellular organisms → Bacteria → Proteobacteria	6730	Open in IMG/M
3300027341\|Ga0209453_1000247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	5705	Open in IMG/M
3300027341\|Ga0209453_1000249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	5685	Open in IMG/M
3300027341\|Ga0209453_1000280	All Organisms → cellular organisms → Bacteria	5311	Open in IMG/M
3300027341\|Ga0209453_1000289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5142	Open in IMG/M
3300027341\|Ga0209453_1000341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4682	Open in IMG/M
3300027341\|Ga0209453_1000418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	4107	Open in IMG/M
3300027341\|Ga0209453_1000635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	3321	Open in IMG/M
3300027341\|Ga0209453_1000854	All Organisms → cellular organisms → Bacteria	2878	Open in IMG/M
3300027341\|Ga0209453_1001011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2689	Open in IMG/M
3300027341\|Ga0209453_1001255	All Organisms → cellular organisms → Bacteria → Proteobacteria	2484	Open in IMG/M
3300027341\|Ga0209453_1002634	All Organisms → cellular organisms → Bacteria	1964	Open in IMG/M
3300027341\|Ga0209453_1006072	All Organisms → cellular organisms → Bacteria → Proteobacteria	1577	Open in IMG/M
3300027341\|Ga0209453_1007609	Not Available	1482	Open in IMG/M
3300027341\|Ga0209453_1140520	Not Available	592	Open in IMG/M
3300027404\|Ga0209049_1000035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	24086	Open in IMG/M
3300027404\|Ga0209049_1000066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	19348	Open in IMG/M
3300027404\|Ga0209049_1000122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	15788	Open in IMG/M
3300027404\|Ga0209049_1000141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	14965	Open in IMG/M
3300027404\|Ga0209049_1000143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	14868	Open in IMG/M
3300027404\|Ga0209049_1000152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	14420	Open in IMG/M
3300027404\|Ga0209049_1000155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	14250	Open in IMG/M
3300027404\|Ga0209049_1000188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	13376	Open in IMG/M
3300027404\|Ga0209049_1000196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	12930	Open in IMG/M
3300027404\|Ga0209049_1000315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	9509	Open in IMG/M
3300027404\|Ga0209049_1000347	All Organisms → cellular organisms → Bacteria → Proteobacteria	8624	Open in IMG/M
3300027404\|Ga0209049_1000353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	8548	Open in IMG/M
3300027404\|Ga0209049_1000397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	7896	Open in IMG/M
3300027404\|Ga0209049_1000444	All Organisms → cellular organisms → Bacteria → Proteobacteria	7309	Open in IMG/M
3300027404\|Ga0209049_1000510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	6613	Open in IMG/M
3300027404\|Ga0209049_1000664	All Organisms → cellular organisms → Bacteria → Proteobacteria	5382	Open in IMG/M
3300027404\|Ga0209049_1000665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	5382	Open in IMG/M
3300027404\|Ga0209049_1000905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	4307	Open in IMG/M
3300027404\|Ga0209049_1001184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3617	Open in IMG/M
3300027404\|Ga0209049_1001262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii	3483	Open in IMG/M
3300027404\|Ga0209049_1001795	All Organisms → cellular organisms → Bacteria → Proteobacteria	2940	Open in IMG/M
3300027404\|Ga0209049_1001932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2845	Open in IMG/M
3300027404\|Ga0209049_1002213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	2690	Open in IMG/M
3300027404\|Ga0209049_1003126	All Organisms → cellular organisms → Bacteria	2392	Open in IMG/M
3300027404\|Ga0209049_1003713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa	2264	Open in IMG/M
3300027404\|Ga0209049_1011821	Not Available	1619	Open in IMG/M
3300027404\|Ga0209049_1025502	All Organisms → Viruses → Predicted Viral	1286	Open in IMG/M
3300027519\|Ga0209562_1249741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	673	Open in IMG/M
3300027550\|Ga0209255_1000022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	25022	Open in IMG/M
3300027550\|Ga0209255_1000078	All Organisms → cellular organisms → Bacteria → Proteobacteria	16982	Open in IMG/M
3300027550\|Ga0209255_1000114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	15065	Open in IMG/M
3300027550\|Ga0209255_1000131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	14455	Open in IMG/M
3300027550\|Ga0209255_1000245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	11971	Open in IMG/M
3300027550\|Ga0209255_1000285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	11276	Open in IMG/M
3300027550\|Ga0209255_1000388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	10416	Open in IMG/M
3300027550\|Ga0209255_1000516	All Organisms → cellular organisms → Bacteria	9587	Open in IMG/M
3300027550\|Ga0209255_1000608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	9110	Open in IMG/M
3300027550\|Ga0209255_1001231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7357	Open in IMG/M
3300027550\|Ga0209255_1001252	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7327	Open in IMG/M
3300027550\|Ga0209255_1001316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	7225	Open in IMG/M
3300027550\|Ga0209255_1001588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6862	Open in IMG/M
3300027550\|Ga0209255_1001850	All Organisms → cellular organisms → Bacteria → Proteobacteria	6582	Open in IMG/M
3300027550\|Ga0209255_1002001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6442	Open in IMG/M
3300027550\|Ga0209255_1004517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea	5086	Open in IMG/M
3300027550\|Ga0209255_1010343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3920	Open in IMG/M
3300027550\|Ga0209255_1048312	All Organisms → cellular organisms → Bacteria	2198	Open in IMG/M
3300027550\|Ga0209255_1069677	All Organisms → cellular organisms → Bacteria → Proteobacteria	1863	Open in IMG/M
3300027550\|Ga0209255_1161434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti	1167	Open in IMG/M
3300027550\|Ga0209255_1246654	All Organisms → cellular organisms → Bacteria → Proteobacteria	862	Open in IMG/M
3300027550\|Ga0209255_1367232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	592	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	95.06%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	4.94%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	95.06%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	4.94%

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	95.06%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	4.94%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0049111_100001716	3300003851	Marine Gutless Worms Symbiont	LCNWMFMVGDCYTQSVMMSDLSIAVAPQLGFLTPPLYSLLGQQA*
Ga0049111_10000441	3300003851	Marine Gutless Worms Symbiont	RRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA*
Ga0049111_10000908	3300003851	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSNLSIAVAPRLGFLTAPLYSLLGQQA*
Ga0049111_10001601	3300003851	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA*
Ga0049111_10002711	3300003851	Marine Gutless Worms Symbiont	RAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA*
Ga0049111_10005051	3300003851	Marine Gutless Worms Symbiont	RAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGCLTAPLYSLLGQQA*
Ga0049111_10006001	3300003851	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLGFLTAPLYSLLGQQA*
Ga0049111_10006775	3300003851	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLVQQA*
Ga0049111_10008191	3300003851	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQV*
Ga0049111_10011001	3300003851	Marine Gutless Worms Symbiont	WMFMVGDCYTQSVMMSDLSNAVAPQLDFLHAPFNSLLGQQA*
Ga0049111_10012482	3300003851	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQA*
Ga0049111_10012893	3300003851	Marine Gutless Worms Symbiont	CNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTASLNPLLGQQA*
Ga0049111_10016791	3300003851	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNFLLSQQA*
Ga0049112_10001131	3300003855	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLSFLIPPLYSLLGQQA*
Ga0049112_100020111	3300003855	Marine Gutless Worms Symbiont	MFMVGDCYTQNVMMSDLSIAVALRLGFLTAPLYSLLGQQA*
Ga0049112_10002321	3300003855	Marine Gutless Worms Symbiont	YGRSLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLGQQA*
Ga0049112_10002991	3300003855	Marine Gutless Worms Symbiont	YTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQALDLSRLQ*
Ga0049112_10004571	3300003855	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCHTQSVMMSDLSIAVAPRLDSLTAPLYSLLG*
Ga0049112_10006477	3300003855	Marine Gutless Worms Symbiont	RIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA*
Ga0049112_10008061	3300003855	Marine Gutless Worms Symbiont	LCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA*
Ga0049112_10009931	3300003855	Marine Gutless Worms Symbiont	WMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLTLLGQQA*
Ga0049112_10011441	3300003855	Marine Gutless Worms Symbiont	GGVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLHVPFNSLLGQQA*
Ga0049112_10011621	3300003855	Marine Gutless Worms Symbiont	GVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRFGFLTAPLYSLLGQQA*
Ga0049112_10013771	3300003855	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQV*
Ga0049112_10014581	3300003855	Marine Gutless Worms Symbiont	FMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSPLGQQA*
Ga0049112_10015441	3300003855	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPQLDFLHAPFNSLLGQQA*
Ga0049112_10070991	3300003855	Marine Gutless Worms Symbiont	CNWMFMVGDCYTQSVMMSDLSIAVALRTAPSIPYLGQQA*
Ga0049112_10112221	3300003855	Marine Gutless Worms Symbiont	GVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRFDFLRAPFNSLFGQQA*
Ga0049112_10226741	3300003855	Marine Gutless Worms Symbiont	CNWMFMVGDCYTQSVMMSDLSIAVALRHRPLNSLLGQQA*
JGI26667J51740_100000897	3300003906	Marine Gutless Worms Symbiont	RMAGAARAFLCNWMFMVGDCYTQRVMMSDLSNAVVPWLDFLHAPFNSLLGQQA*
JGI26667J51740_100000901	3300003906	Marine Gutless Worms Symbiont	FLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLLAPLDSLLGQQA*
JGI26667J51740_100001821	3300003906	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSFLGQQA*
JGI26667J51740_100002966	3300003906	Marine Gutless Worms Symbiont	VVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFPRSLNSLLGQQA*
JGI26667J51740_100003087	3300003906	Marine Gutless Worms Symbiont	GVVRAFLCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLPVPLNSLLGQQA*
JGI26667J51740_100003321	3300003906	Marine Gutless Worms Symbiont	FMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNPYLGQQA*
JGI26667J51740_100004416	3300003906	Marine Gutless Worms Symbiont	CNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHASFNSLLGQQA*
JGI26667J51740_100007935	3300003906	Marine Gutless Worms Symbiont	MAGVVRAFLRNWMFMVGDCYTQSVVMSDLSNAVAPRLGFLHAPLNSLLGQQA*
JGI26667J51740_100021751	3300003906	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSPLGQQA*
JGI26667J51740_100027903	3300003906	Marine Gutless Worms Symbiont	AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPQLDFLPAPLNSLLGQQA*
JGI26667J51740_100132591	3300003906	Marine Gutless Worms Symbiont	AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLPAPFNSLLGQQA*
Ga0049105_10020521	3300004630	Marine Gutless Worms Symbiont	AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPLLGFLHAPLNSLLGQQA*
Ga0049105_10022187	3300004630	Marine Gutless Worms Symbiont	MAGAARAFLCNWMFMVGDCYTQRVMMSDLSNAVVPWLDFLHAPFNSLLGQQA*
Ga0049105_100438212	3300004630	Marine Gutless Worms Symbiont	NSRRIAGVVRAFLCDWMFMVGDCYTQRVMMSDLSNAVAPRLGFLPAPLNSLLGQQA*
Ga0049105_100548211	3300004630	Marine Gutless Worms Symbiont	NSRRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSFLGQQA*
Ga0049105_100613711	3300004630	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQRVIMSDLSNAVAPLLDFLHAPFNSLLGQQA*
Ga0049105_10081141	3300004630	Marine Gutless Worms Symbiont	NSRRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPQLGFLPAPLNSLLGQQA*
Ga0049105_10100451	3300004630	Marine Gutless Worms Symbiont	SRRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLGQQA*
Ga0049105_10109091	3300004630	Marine Gutless Worms Symbiont	FLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNPYLGQQA*
Ga0049105_10111931	3300004630	Marine Gutless Worms Symbiont	VVRAFLCNWMFMVGDCYTQSVMMSDLSNAAAPRLDFLHAPLDSLLGQQA*
Ga0049105_10160767	3300004630	Marine Gutless Worms Symbiont	GVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHASFNSLLGQQA*
Ga0049105_10280657	3300004630	Marine Gutless Worms Symbiont	RIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFFPAPLDSLLGQQA*
Ga0049105_10320406	3300004630	Marine Gutless Worms Symbiont	FMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA*
Ga0049105_10359011	3300004630	Marine Gutless Worms Symbiont	WMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA*
Ga0049105_10423401	3300004630	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAAAPRLGFFPAPLNSLLGQQA*
Ga0049105_10479893	3300004630	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNTVAPLLDFLHAPFNSLLGQQA*
Ga0049105_10485194	3300004630	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVASRLGFLHAPLDSLLGQQA*
Ga0049105_10645923	3300004630	Marine Gutless Worms Symbiont	AGVVRAFLCDWMFMVGDCYLNRVMMSDLSNAVAPRLGFLHAPLDSLLGQQA*
Ga0049105_10782671	3300004630	Marine Gutless Worms Symbiont	AFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA*
Ga0049105_10919201	3300004630	Marine Gutless Worms Symbiont	CNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLG*
Ga0049105_10988604	3300004630	Marine Gutless Worms Symbiont	LCNWMFMVGDCYTQRVMMSDLSNAAALRLGFLHAPLNSLLGQQA*
Ga0049105_11622783	3300004630	Marine Gutless Worms Symbiont	CNSRRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLPAPFNSLLGQQA*
Ga0049105_11623102	3300004630	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVALRLDFLHAPFNSLLGQQA*
Ga0049105_11759393	3300004630	Marine Gutless Worms Symbiont	LCNWMFMVGDCYTQRVMMSDLSNAAALRLGFLHAPLNSLLSQQA*
Ga0049105_11988171	3300004630	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNTVAPRLGFLPAPLNSLLGQQA*
Ga0049105_12272921	3300004630	Marine Gutless Worms Symbiont	NSRRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPLLDFLHAPFNSLLGQQA*
Ga0049105_13052752	3300004630	Marine Gutless Worms Symbiont	NSRRIAGVVRAFLCDWMFMVGDCYTQRVMMSDLSNAVAPQLGFLPAPLDSLLGQQA*
Ga0071327_10014297	3300005170	Marine Gutless Worms Symbiont	NSRRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPLLGFLHAPLNSLLGQQA*
Ga0071327_10573711	3300005170	Marine Gutless Worms Symbiont	AGVVRAFLCDWMFMGVIAILNRVMMSDLSNAVAPRLGFLHAPLDSLLGQQA*
Ga0071327_11574451	3300005170	Marine Gutless Worms Symbiont	AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLLAPLDSLLGQQA*
Ga0056111_10010311	3300008214	Marine Gutless Worms Symbiont	SRRIAGVVRAFLCNWMFMVGDCYTQRVMMSDLSNALAPRLDFLHAPFNSLLGQQA*
Ga0056111_10011545	3300008214	Marine Gutless Worms Symbiont	GVVRAFLCNWMFMVGDCYTQRVMMSDLSNALAPRLGFLTAPFNSLFGQQA*
Ga0056111_10021853	3300008214	Marine Gutless Worms Symbiont	MFMVGDCYTQKVMMSDLSNALAPRLDFLTAPLNSLLGQQA*
Ga0056111_10022901	3300008214	Marine Gutless Worms Symbiont	FLCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLTAPLNSLPGQQA*
Ga0056111_10025173	3300008214	Marine Gutless Worms Symbiont	VVRAFLCNWMFMVGDCYTQRVMMSDLSNALAPRLDFLHAPFNSLLGQQA*
Ga0056111_10029552	3300008214	Marine Gutless Worms Symbiont	MFMVGDCYTQKVMMSDLSNAVAPRLGFLTAPLNSFLGQQA*
Ga0056111_10068782	3300008214	Marine Gutless Worms Symbiont	LCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLTAPLNSLLDQQA*
Ga0056111_10095202	3300008214	Marine Gutless Worms Symbiont	FMVGDCYTQRVMMSDLSNAVAPRLGFLTAPLNSLLGQQA*
Ga0209453_10000071	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPQLGFLTPPLYSLLGQQA
Ga0209453_10000459	3300027341	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVTPRLGFLTPPLYPLLGQQA
Ga0209453_100004915	3300027341	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA
Ga0209453_10000591	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVALRLGFLTAPLYSLLGQQA
Ga0209453_100006010	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLG
Ga0209453_10000602	3300027341	Marine Gutless Worms Symbiont	MAGGVRAFLGNWMFMVGDCYTQSVMMSDLLNAVALRLDFLHAPFNSLLGQQA
Ga0209453_10000751	3300027341	Marine Gutless Worms Symbiont	CNSRRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYSLLGQQA
Ga0209453_10000761	3300027341	Marine Gutless Worms Symbiont	CNSRRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLTAPLYSLLGQQA
Ga0209453_100008612	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209453_10000951	3300027341	Marine Gutless Worms Symbiont	AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQV
Ga0209453_10001001	3300027341	Marine Gutless Worms Symbiont	FLCNWMFISVMMSDLSIAVAPRLGFLTPPLYSLLGQQA
Ga0209453_10001252	3300027341	Marine Gutless Worms Symbiont	MVGDCYTQNVMMSDLSIAVALRLGFLTAPLYSLLGQQA
Ga0209453_100013611	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLVQQA
Ga0209453_10001371	3300027341	Marine Gutless Worms Symbiont	DCNARRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209453_10001449	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQA
Ga0209453_100015910	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLNSLLGQQA
Ga0209453_10001592	3300027341	Marine Gutless Worms Symbiont	MFMVGDCCTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209453_100017012	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA
Ga0209453_100017911	3300027341	Marine Gutless Worms Symbiont	AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA
Ga0209453_10001831	3300027341	Marine Gutless Worms Symbiont	AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQALDLSRLQ
Ga0209453_10001915	3300027341	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209453_10002471	3300027341	Marine Gutless Worms Symbiont	DCNARRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRFGFLTAPLYSLLGQQA
Ga0209453_10002497	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLDFLTAPLYSLLGQQA
Ga0209453_10002807	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYSLLGQQA
Ga0209453_10002892	3300027341	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA
Ga0209453_10003416	3300027341	Marine Gutless Worms Symbiont	AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209453_10004185	3300027341	Marine Gutless Worms Symbiont	GDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA
Ga0209453_10006351	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVALRLGCLTAPLYSLLGQQA
Ga0209453_10008542	3300027341	Marine Gutless Worms Symbiont	MGFFKAPYTQRVMMSDLSNAVAPQLGFLTAPLYSLLGQQA
Ga0209453_10010111	3300027341	Marine Gutless Worms Symbiont	FMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209453_10012551	3300027341	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQT
Ga0209453_10026344	3300027341	Marine Gutless Worms Symbiont	IAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTASLNPLLGQQA
Ga0209453_10060722	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYFLLGQQA
Ga0209453_10076091	3300027341	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLSQQA
Ga0209453_11405201	3300027341	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAIAPRLGFLTAPLYSLLGQQA
Ga0209049_100003531	3300027404	Marine Gutless Worms Symbiont	IAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209049_10000663	3300027404	Marine Gutless Worms Symbiont	MAGGVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLDQQA
Ga0209049_10001222	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQA
Ga0209049_10001415	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLLNAVALRLDFLHAPFNSLLGQQA
Ga0209049_100014313	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAIAPRLGFLTAPLYSLLGQQA
Ga0209049_10001521	3300027404	Marine Gutless Worms Symbiont	RIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA
Ga0209049_10001551	3300027404	Marine Gutless Worms Symbiont	GVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYSLLGQQA
Ga0209049_10001889	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVTPRLGFLTPPLYSLLGQQA
Ga0209049_10001961	3300027404	Marine Gutless Worms Symbiont	RIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA
Ga0209049_10003157	3300027404	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRFDFLRAPFNSLFGQQA
Ga0209049_100034713	3300027404	Marine Gutless Worms Symbiont	MFMVGDCHTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA
Ga0209049_100035311	3300027404	Marine Gutless Worms Symbiont	MFMVGDCYTQNVMMSDLSIAVALRLGFLTAPLYSLLGQQA
Ga0209049_10003971	3300027404	Marine Gutless Worms Symbiont	NSRRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLGQQA
Ga0209049_10004444	3300027404	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPQLDFLHAPFNSLLGQQA
Ga0209049_10005106	3300027404	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMPDLSIAVALRLGFLTAPLYSLLGQQA
Ga0209049_10006643	3300027404	Marine Gutless Worms Symbiont	MAGGVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLHVPFNSLLGQQA
Ga0209049_10006652	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVIVLDLPIVVAPRLGFLTAPLYSLLGQQA
Ga0209049_10009052	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSNAVAPQLDFLHAPFNSLLGQQA
Ga0209049_10011847	3300027404	Marine Gutless Worms Symbiont	GGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLLYSLLGQQA
Ga0209049_10012622	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSIAVALRLGCLTAPLYSLLGQQA
Ga0209049_10017954	3300027404	Marine Gutless Worms Symbiont	MSMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA
Ga0209049_10019326	3300027404	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQV
Ga0209049_10022136	3300027404	Marine Gutless Worms Symbiont	GVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLGQQA
Ga0209049_10031265	3300027404	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSIAVAPRLGFLTASLNPLLGQQA
Ga0209049_10037133	3300027404	Marine Gutless Worms Symbiont	RRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLG
Ga0209049_10118213	3300027404	Marine Gutless Worms Symbiont	GVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNFLLSQQA
Ga0209049_10255023	3300027404	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSNAVALRLDFLHAPFNSLLGQQA
Ga0209562_12497411	3300027519	Marine Gutless Worms Symbiont	VRAFLCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLHAPFNSLLGQQA
Ga0209255_10000228	3300027550	Marine Gutless Worms Symbiont	MVGDCYTQSVMMSDLSNAVALRLGFLPAPLNSLLGQQA
Ga0209255_10000781	3300027550	Marine Gutless Worms Symbiont	AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPFNSLLGQQA
Ga0209255_10001143	3300027550	Marine Gutless Worms Symbiont	MVGDCYTKEVMMSDLSNAVAPRLGFLHAPLDSLLGQQA
Ga0209255_100013120	3300027550	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSLLGQQA
Ga0209255_10002452	3300027550	Marine Gutless Worms Symbiont	MAGAARAFLCNWMFMVGDCYTQRVMMSDLSNAVVPWLDFLHAPFNSLLGQQA
Ga0209255_10002852	3300027550	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQRVIMSDLSNAVAPLLDFLHAPFNSLLGQQA
Ga0209255_10003881	3300027550	Marine Gutless Worms Symbiont	RRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLDSLLGQQA
Ga0209255_100051610	3300027550	Marine Gutless Worms Symbiont	RIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLLAPLDSLLGQQA
Ga0209255_10006089	3300027550	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPQLDFLPAPLNSLLGQQA
Ga0209255_10012311	3300027550	Marine Gutless Worms Symbiont	CNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA
Ga0209255_100125210	3300027550	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSFLGQQA
Ga0209255_10013162	3300027550	Marine Gutless Worms Symbiont	MVGDYYTQSVMMSDLSNAVAPRLGFLHAPFNSLLGQQA
Ga0209255_10015881	3300027550	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLGFLHAPLNSLLGQQA
Ga0209255_10018501	3300027550	Marine Gutless Worms Symbiont	RRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLGQQA
Ga0209255_10020019	3300027550	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLGQQA
Ga0209255_10045177	3300027550	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHASFNSLLGQQA
Ga0209255_10103431	3300027550	Marine Gutless Worms Symbiont	GVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLGQQA
Ga0209255_10483123	3300027550	Marine Gutless Worms Symbiont	MAGVVRAFLCNWMFMVGDCYTQRVMMSDLSNAVAPQLGFLPAPLDSLLGQQA
Ga0209255_10696774	3300027550	Marine Gutless Worms Symbiont	RRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSLLGQQA
Ga0209255_11614343	3300027550	Marine Gutless Worms Symbiont	MFMVGDCYTQSVMMSDLSNTVAPRLGFLPAPLNSLLGQQA
Ga0209255_12466542	3300027550	Marine Gutless Worms Symbiont	MAGVVRAFLCNRMFMVGDCYTKEVMMSDLSNAVAPRLGFLHAPLDSLLGQQA
Ga0209255_13672321	3300027550	Marine Gutless Worms Symbiont	MVDDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLGQQA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F039940

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003851	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.1	Host-Associated	Open in IMG/M
3300003855	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2	Host-Associated	Open in IMG/M
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated	Open in IMG/M
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated	Open in IMG/M
3300005170	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)	Host-Associated	Open in IMG/M
3300008214	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius longissimus B BELIZE.2	Host-Associated	Open in IMG/M
3300027341	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027404	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027519	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027550	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign