| Basic Information | |
|---|---|
| Family ID | F039940 |
| Family Type | Metagenome |
| Number of Sequences | 162 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA |
| Number of Associated Samples | 10 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.81 % |
| % of genes near scaffold ends (potentially truncated) | 60.49 % |
| % of genes from short scaffolds (< 2000 bps) | 17.90 % |
| Associated GOLD sequencing projects | 6 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.506 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (95.062 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut (100.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF10576 | EndIII_4Fe-2S | 1.88 |
| PF05685 | Uma2 | 1.88 |
| PF00578 | AhpC-TSA | 1.25 |
| PF02955 | GSH-S_ATP | 1.25 |
| PF04715 | Anth_synt_I_N | 1.25 |
| PF00381 | PTS-HPr | 1.25 |
| PF03143 | GTP_EFTU_D3 | 1.25 |
| PF13683 | rve_3 | 1.25 |
| PF04205 | FMN_bind | 1.25 |
| PF02508 | Rnf-Nqr | 1.25 |
| PF16576 | HlyD_D23 | 1.25 |
| PF00654 | Voltage_CLC | 1.25 |
| PF13614 | AAA_31 | 1.25 |
| PF02604 | PhdYeFM_antitox | 1.25 |
| PF00665 | rve | 1.25 |
| PF03739 | LptF_LptG | 1.25 |
| PF00248 | Aldo_ket_red | 1.25 |
| PF03966 | Trm112p | 1.25 |
| PF01925 | TauE | 0.62 |
| PF02627 | CMD | 0.62 |
| PF03308 | MeaB | 0.62 |
| PF02283 | CobU | 0.62 |
| PF01050 | MannoseP_isomer | 0.62 |
| PF02374 | ArsA_ATPase | 0.62 |
| PF03461 | TRCF | 0.62 |
| PF13439 | Glyco_transf_4 | 0.62 |
| PF04995 | CcmD | 0.62 |
| PF08502 | LeuA_dimer | 0.62 |
| PF13604 | AAA_30 | 0.62 |
| PF12770 | CHAT | 0.62 |
| PF00128 | Alpha-amylase | 0.62 |
| PF01850 | PIN | 0.62 |
| PF02272 | DHHA1 | 0.62 |
| PF02803 | Thiolase_C | 0.62 |
| PF03477 | ATP-cone | 0.62 |
| PF00338 | Ribosomal_S10 | 0.62 |
| PF03706 | LPG_synthase_TM | 0.62 |
| PF03100 | CcmE | 0.62 |
| PF13358 | DDE_3 | 0.62 |
| PF12760 | Zn_Tnp_IS1595 | 0.62 |
| PF02629 | CoA_binding | 0.62 |
| PF02518 | HATPase_c | 0.62 |
| PF00698 | Acyl_transf_1 | 0.62 |
| PF02817 | E3_binding | 0.62 |
| PF02912 | Phe_tRNA-synt_N | 0.62 |
| PF02873 | MurB_C | 0.62 |
| PF01797 | Y1_Tnp | 0.62 |
| PF01370 | Epimerase | 0.62 |
| PF00112 | Peptidase_C1 | 0.62 |
| PF04143 | Sulf_transp | 0.62 |
| PF00216 | Bac_DNA_binding | 0.62 |
| PF01351 | RNase_HII | 0.62 |
| PF02729 | OTCace_N | 0.62 |
| PF11939 | NiFe-hyd_HybE | 0.62 |
| PF10276 | zf-CHCC | 0.62 |
| PF04055 | Radical_SAM | 0.62 |
| PF13579 | Glyco_trans_4_4 | 0.62 |
| PF01656 | CbiA | 0.62 |
| PF00027 | cNMP_binding | 0.62 |
| PF01040 | UbiA | 0.62 |
| PF13090 | PP_kinase_C | 0.62 |
| PF00271 | Helicase_C | 0.62 |
| PF11845 | DUF3365 | 0.62 |
| PF13975 | gag-asp_proteas | 0.62 |
| PF14821 | Thr_synth_N | 0.62 |
| PF01887 | SAM_HAT_N | 0.62 |
| PF17042 | NBD_C | 0.62 |
| PF03372 | Exo_endo_phos | 0.62 |
| PF01921 | tRNA-synt_1f | 0.62 |
| PF07973 | tRNA_SAD | 0.62 |
| PF13384 | HTH_23 | 0.62 |
| PF00437 | T2SSE | 0.62 |
| PF01903 | CbiX | 0.62 |
| PF01855 | POR_N | 0.62 |
| PF02899 | Phage_int_SAM_1 | 0.62 |
| PF00300 | His_Phos_1 | 0.62 |
| PF00226 | DnaJ | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF01882 | DUF58 | 0.62 |
| PF04365 | BrnT_toxin | 0.62 |
| PF16320 | Ribosomal_L12_N | 0.62 |
| PF12627 | PolyA_pol_RNAbd | 0.62 |
| PF08264 | Anticodon_1 | 0.62 |
| PF02446 | Glyco_hydro_77 | 0.62 |
| PF06968 | BATS | 0.62 |
| PF02548 | Pantoate_transf | 0.62 |
| PF00310 | GATase_2 | 0.62 |
| PF00117 | GATase | 0.62 |
| PF00573 | Ribosomal_L4 | 0.62 |
| PF08442 | ATP-grasp_2 | 0.62 |
| PF13361 | UvrD_C | 0.62 |
| PF01408 | GFO_IDH_MocA | 0.62 |
| PF01381 | HTH_3 | 0.62 |
| PF13187 | Fer4_9 | 0.62 |
| PF13304 | AAA_21 | 0.62 |
| PF07478 | Dala_Dala_lig_C | 0.62 |
| PF01208 | URO-D | 0.62 |
| PF13424 | TPR_12 | 0.62 |
| PF08478 | POTRA_1 | 0.62 |
| PF07883 | Cupin_2 | 0.62 |
| PF00483 | NTP_transferase | 0.62 |
| PF00977 | His_biosynth | 0.62 |
| PF00106 | adh_short | 0.62 |
| PF14491 | DUF4435 | 0.62 |
| PF05524 | PEP-utilisers_N | 0.62 |
| PF13635 | DUF4143 | 0.62 |
| PF00534 | Glycos_transf_1 | 0.62 |
| PF00816 | Histone_HNS | 0.62 |
| PF05598 | DUF772 | 0.62 |
| PF15919 | HicB_lk_antitox | 0.62 |
| PF00152 | tRNA-synt_2 | 0.62 |
| PF01609 | DDE_Tnp_1 | 0.62 |
| PF14384 | BrnA_antitoxin | 0.62 |
| PF01300 | Sua5_yciO_yrdC | 0.62 |
| PF07788 | PDDEXK_10 | 0.62 |
| PF13744 | HTH_37 | 0.62 |
| PF06594 | HCBP_related | 0.62 |
| PF03548 | LolA | 0.62 |
| PF01578 | Cytochrom_C_asm | 0.62 |
| PF00664 | ABC_membrane | 0.62 |
| PF11159 | DUF2939 | 0.62 |
| PF00268 | Ribonuc_red_sm | 0.62 |
| PF08534 | Redoxin | 0.62 |
| PF03951 | Gln-synt_N | 0.62 |
| PF04186 | FxsA | 0.62 |
| PF01583 | APS_kinase | 0.62 |
| PF08328 | ASL_C | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 2.50 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 2.50 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.88 |
| COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 1.25 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 1.25 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.25 |
| COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 1.25 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.25 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.25 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 1.25 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.25 |
| COG1347 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrD | Energy production and conversion [C] | 1.25 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.25 |
| COG4657 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfA subunit | Energy production and conversion [C] | 1.25 |
| COG4660 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfE subunit | Energy production and conversion [C] | 1.25 |
| COG2209 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE | Energy production and conversion [C] | 1.25 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.25 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 1.25 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.62 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.62 |
| COG2087 | Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase | Coenzyme transport and metabolism [H] | 0.62 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.62 |
| COG3114 | Heme exporter protein D | Intracellular trafficking, secretion, and vesicular transport [U] | 0.62 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.62 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.62 |
| COG2931 | Ca2+-binding protein, RTX toxin-related | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG3030 | FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family | General function prediction only [R] | 0.62 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.62 |
| COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.62 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.62 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.62 |
| COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.62 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.62 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.62 |
| COG5493 | Uncharacterized protein, contains PD-(D/E)XK nuclease domain | General function prediction only [R] | 0.62 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.62 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.62 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.62 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.62 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.62 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.62 |
| COG0088 | Ribosomal protein L4 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0051 | Ribosomal protein S10 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.62 |
| COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.62 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.62 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0015 | Adenylosuccinate lyase | Nucleotide transport and metabolism [F] | 0.62 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.62 |
| COG1384 | Lysyl-tRNA synthetase, class I | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.62 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.62 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.62 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.62 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.62 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.62 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.62 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.74 % |
| Unclassified | root | N/A | 9.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003851|Ga0049111_1000017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12276 | Open in IMG/M |
| 3300003851|Ga0049111_1000044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 9390 | Open in IMG/M |
| 3300003851|Ga0049111_1000090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7685 | Open in IMG/M |
| 3300003851|Ga0049111_1000160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 6133 | Open in IMG/M |
| 3300003851|Ga0049111_1000271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4717 | Open in IMG/M |
| 3300003851|Ga0049111_1000505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 3254 | Open in IMG/M |
| 3300003851|Ga0049111_1000600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis | 2976 | Open in IMG/M |
| 3300003851|Ga0049111_1000677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2776 | Open in IMG/M |
| 3300003851|Ga0049111_1000819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2470 | Open in IMG/M |
| 3300003851|Ga0049111_1001100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2067 | Open in IMG/M |
| 3300003851|Ga0049111_1001248 | Not Available | 1873 | Open in IMG/M |
| 3300003851|Ga0049111_1001289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1830 | Open in IMG/M |
| 3300003851|Ga0049111_1001679 | Not Available | 1536 | Open in IMG/M |
| 3300003855|Ga0049112_1000113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 10981 | Open in IMG/M |
| 3300003855|Ga0049112_1000201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 8458 | Open in IMG/M |
| 3300003855|Ga0049112_1000232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7847 | Open in IMG/M |
| 3300003855|Ga0049112_1000299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 6765 | Open in IMG/M |
| 3300003855|Ga0049112_1000457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5396 | Open in IMG/M |
| 3300003855|Ga0049112_1000647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4311 | Open in IMG/M |
| 3300003855|Ga0049112_1000806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3633 | Open in IMG/M |
| 3300003855|Ga0049112_1000993 | Not Available | 3167 | Open in IMG/M |
| 3300003855|Ga0049112_1001144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2814 | Open in IMG/M |
| 3300003855|Ga0049112_1001162 | Not Available | 2786 | Open in IMG/M |
| 3300003855|Ga0049112_1001377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2470 | Open in IMG/M |
| 3300003855|Ga0049112_1001458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2354 | Open in IMG/M |
| 3300003855|Ga0049112_1001544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2270 | Open in IMG/M |
| 3300003855|Ga0049112_1007099 | Not Available | 894 | Open in IMG/M |
| 3300003855|Ga0049112_1011222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 743 | Open in IMG/M |
| 3300003855|Ga0049112_1022674 | Not Available | 588 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 9167 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 9135 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7200 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5990 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5905 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 5700 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 5034 | Open in IMG/M |
| 3300003906|JGI26667J51740_10000793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3853 | Open in IMG/M |
| 3300003906|JGI26667J51740_10002175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2378 | Open in IMG/M |
| 3300003906|JGI26667J51740_10002790 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 2153 | Open in IMG/M |
| 3300003906|JGI26667J51740_10013259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1359 | Open in IMG/M |
| 3300004630|Ga0049105_1002052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9656 | Open in IMG/M |
| 3300004630|Ga0049105_1002218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 9442 | Open in IMG/M |
| 3300004630|Ga0049105_1004382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7821 | Open in IMG/M |
| 3300004630|Ga0049105_1005482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7303 | Open in IMG/M |
| 3300004630|Ga0049105_1006137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7039 | Open in IMG/M |
| 3300004630|Ga0049105_1008114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6453 | Open in IMG/M |
| 3300004630|Ga0049105_1010045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 6018 | Open in IMG/M |
| 3300004630|Ga0049105_1010909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5858 | Open in IMG/M |
| 3300004630|Ga0049105_1011193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5804 | Open in IMG/M |
| 3300004630|Ga0049105_1016076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 5081 | Open in IMG/M |
| 3300004630|Ga0049105_1028065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4044 | Open in IMG/M |
| 3300004630|Ga0049105_1032040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3813 | Open in IMG/M |
| 3300004630|Ga0049105_1035901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 3620 | Open in IMG/M |
| 3300004630|Ga0049105_1042340 | Not Available | 3344 | Open in IMG/M |
| 3300004630|Ga0049105_1047989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3138 | Open in IMG/M |
| 3300004630|Ga0049105_1048519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 3122 | Open in IMG/M |
| 3300004630|Ga0049105_1064592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2675 | Open in IMG/M |
| 3300004630|Ga0049105_1078267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2390 | Open in IMG/M |
| 3300004630|Ga0049105_1091920 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300004630|Ga0049105_1098860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2056 | Open in IMG/M |
| 3300004630|Ga0049105_1162278 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300004630|Ga0049105_1162310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1395 | Open in IMG/M |
| 3300004630|Ga0049105_1175939 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300004630|Ga0049105_1198817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 1148 | Open in IMG/M |
| 3300004630|Ga0049105_1227292 | Not Available | 994 | Open in IMG/M |
| 3300004630|Ga0049105_1305275 | Not Available | 691 | Open in IMG/M |
| 3300005170|Ga0071327_1001429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9671 | Open in IMG/M |
| 3300005170|Ga0071327_1057371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2675 | Open in IMG/M |
| 3300005170|Ga0071327_1157445 | Not Available | 1351 | Open in IMG/M |
| 3300008214|Ga0056111_1001031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4062 | Open in IMG/M |
| 3300008214|Ga0056111_1001154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3781 | Open in IMG/M |
| 3300008214|Ga0056111_1002185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2247 | Open in IMG/M |
| 3300008214|Ga0056111_1002290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2155 | Open in IMG/M |
| 3300008214|Ga0056111_1002517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 1978 | Open in IMG/M |
| 3300008214|Ga0056111_1002955 | Not Available | 1715 | Open in IMG/M |
| 3300008214|Ga0056111_1006878 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300008214|Ga0056111_1009520 | Not Available | 767 | Open in IMG/M |
| 3300027341|Ga0209453_1000007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 26056 | Open in IMG/M |
| 3300027341|Ga0209453_1000045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 14636 | Open in IMG/M |
| 3300027341|Ga0209453_1000049 | All Organisms → cellular organisms → Bacteria | 14458 | Open in IMG/M |
| 3300027341|Ga0209453_1000059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 13355 | Open in IMG/M |
| 3300027341|Ga0209453_1000060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 13282 | Open in IMG/M |
| 3300027341|Ga0209453_1000060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 13282 | Open in IMG/M |
| 3300027341|Ga0209453_1000075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11581 | Open in IMG/M |
| 3300027341|Ga0209453_1000076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11574 | Open in IMG/M |
| 3300027341|Ga0209453_1000086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10713 | Open in IMG/M |
| 3300027341|Ga0209453_1000095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9821 | Open in IMG/M |
| 3300027341|Ga0209453_1000100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9686 | Open in IMG/M |
| 3300027341|Ga0209453_1000125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 8601 | Open in IMG/M |
| 3300027341|Ga0209453_1000136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 8142 | Open in IMG/M |
| 3300027341|Ga0209453_1000137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8087 | Open in IMG/M |
| 3300027341|Ga0209453_1000144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7949 | Open in IMG/M |
| 3300027341|Ga0209453_1000159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7374 | Open in IMG/M |
| 3300027341|Ga0209453_1000159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7374 | Open in IMG/M |
| 3300027341|Ga0209453_1000170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7192 | Open in IMG/M |
| 3300027341|Ga0209453_1000179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7024 | Open in IMG/M |
| 3300027341|Ga0209453_1000183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6850 | Open in IMG/M |
| 3300027341|Ga0209453_1000191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6730 | Open in IMG/M |
| 3300027341|Ga0209453_1000247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 5705 | Open in IMG/M |
| 3300027341|Ga0209453_1000249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5685 | Open in IMG/M |
| 3300027341|Ga0209453_1000280 | All Organisms → cellular organisms → Bacteria | 5311 | Open in IMG/M |
| 3300027341|Ga0209453_1000289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5142 | Open in IMG/M |
| 3300027341|Ga0209453_1000341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4682 | Open in IMG/M |
| 3300027341|Ga0209453_1000418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4107 | Open in IMG/M |
| 3300027341|Ga0209453_1000635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 3321 | Open in IMG/M |
| 3300027341|Ga0209453_1000854 | All Organisms → cellular organisms → Bacteria | 2878 | Open in IMG/M |
| 3300027341|Ga0209453_1001011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2689 | Open in IMG/M |
| 3300027341|Ga0209453_1001255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2484 | Open in IMG/M |
| 3300027341|Ga0209453_1002634 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300027341|Ga0209453_1006072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1577 | Open in IMG/M |
| 3300027341|Ga0209453_1007609 | Not Available | 1482 | Open in IMG/M |
| 3300027341|Ga0209453_1140520 | Not Available | 592 | Open in IMG/M |
| 3300027404|Ga0209049_1000035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 24086 | Open in IMG/M |
| 3300027404|Ga0209049_1000066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 19348 | Open in IMG/M |
| 3300027404|Ga0209049_1000122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 15788 | Open in IMG/M |
| 3300027404|Ga0209049_1000141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 14965 | Open in IMG/M |
| 3300027404|Ga0209049_1000143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 14868 | Open in IMG/M |
| 3300027404|Ga0209049_1000152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 14420 | Open in IMG/M |
| 3300027404|Ga0209049_1000155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 14250 | Open in IMG/M |
| 3300027404|Ga0209049_1000188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 13376 | Open in IMG/M |
| 3300027404|Ga0209049_1000196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 12930 | Open in IMG/M |
| 3300027404|Ga0209049_1000315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis | 9509 | Open in IMG/M |
| 3300027404|Ga0209049_1000347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8624 | Open in IMG/M |
| 3300027404|Ga0209049_1000353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 8548 | Open in IMG/M |
| 3300027404|Ga0209049_1000397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 7896 | Open in IMG/M |
| 3300027404|Ga0209049_1000444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7309 | Open in IMG/M |
| 3300027404|Ga0209049_1000510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 6613 | Open in IMG/M |
| 3300027404|Ga0209049_1000664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5382 | Open in IMG/M |
| 3300027404|Ga0209049_1000665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5382 | Open in IMG/M |
| 3300027404|Ga0209049_1000905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4307 | Open in IMG/M |
| 3300027404|Ga0209049_1001184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3617 | Open in IMG/M |
| 3300027404|Ga0209049_1001262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodococcus → Thiorhodococcus drewsii | 3483 | Open in IMG/M |
| 3300027404|Ga0209049_1001795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2940 | Open in IMG/M |
| 3300027404|Ga0209049_1001932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2845 | Open in IMG/M |
| 3300027404|Ga0209049_1002213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 2690 | Open in IMG/M |
| 3300027404|Ga0209049_1003126 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300027404|Ga0209049_1003713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa | 2264 | Open in IMG/M |
| 3300027404|Ga0209049_1011821 | Not Available | 1619 | Open in IMG/M |
| 3300027404|Ga0209049_1025502 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300027519|Ga0209562_1249741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 673 | Open in IMG/M |
| 3300027550|Ga0209255_1000022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 25022 | Open in IMG/M |
| 3300027550|Ga0209255_1000078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16982 | Open in IMG/M |
| 3300027550|Ga0209255_1000114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 15065 | Open in IMG/M |
| 3300027550|Ga0209255_1000131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 14455 | Open in IMG/M |
| 3300027550|Ga0209255_1000245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11971 | Open in IMG/M |
| 3300027550|Ga0209255_1000285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11276 | Open in IMG/M |
| 3300027550|Ga0209255_1000388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10416 | Open in IMG/M |
| 3300027550|Ga0209255_1000516 | All Organisms → cellular organisms → Bacteria | 9587 | Open in IMG/M |
| 3300027550|Ga0209255_1000608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 9110 | Open in IMG/M |
| 3300027550|Ga0209255_1001231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7357 | Open in IMG/M |
| 3300027550|Ga0209255_1001252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7327 | Open in IMG/M |
| 3300027550|Ga0209255_1001316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 7225 | Open in IMG/M |
| 3300027550|Ga0209255_1001588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6862 | Open in IMG/M |
| 3300027550|Ga0209255_1001850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6582 | Open in IMG/M |
| 3300027550|Ga0209255_1002001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6442 | Open in IMG/M |
| 3300027550|Ga0209255_1004517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 5086 | Open in IMG/M |
| 3300027550|Ga0209255_1010343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3920 | Open in IMG/M |
| 3300027550|Ga0209255_1048312 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300027550|Ga0209255_1069677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1863 | Open in IMG/M |
| 3300027550|Ga0209255_1161434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 1167 | Open in IMG/M |
| 3300027550|Ga0209255_1246654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300027550|Ga0209255_1367232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont | 95.06% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont | 4.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003851 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.1 | Host-Associated | Open in IMG/M |
| 3300003855 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 | Host-Associated | Open in IMG/M |
| 3300003906 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 | Host-Associated | Open in IMG/M |
| 3300004630 | Worm MetaG Olavius vacuus BAHAMAS.1 | Host-Associated | Open in IMG/M |
| 3300005170 | Worm MetaG Olavius vacuus BAHAMAS.1 (version 1) | Host-Associated | Open in IMG/M |
| 3300008214 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius longissimus B BELIZE.2 | Host-Associated | Open in IMG/M |
| 3300027341 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027404 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027519 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027550 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0049111_100001716 | 3300003851 | Marine Gutless Worms Symbiont | LCNWMFMVGDCYTQSVMMSDLSIAVAPQLGFLTPPLYSLLGQQA* |
| Ga0049111_10000441 | 3300003851 | Marine Gutless Worms Symbiont | RRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA* |
| Ga0049111_10000908 | 3300003851 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSNLSIAVAPRLGFLTAPLYSLLGQQA* |
| Ga0049111_10001601 | 3300003851 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA* |
| Ga0049111_10002711 | 3300003851 | Marine Gutless Worms Symbiont | RAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA* |
| Ga0049111_10005051 | 3300003851 | Marine Gutless Worms Symbiont | RAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGCLTAPLYSLLGQQA* |
| Ga0049111_10006001 | 3300003851 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLGFLTAPLYSLLGQQA* |
| Ga0049111_10006775 | 3300003851 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLVQQA* |
| Ga0049111_10008191 | 3300003851 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQV* |
| Ga0049111_10011001 | 3300003851 | Marine Gutless Worms Symbiont | WMFMVGDCYTQSVMMSDLSNAVAPQLDFLHAPFNSLLGQQA* |
| Ga0049111_10012482 | 3300003851 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQA* |
| Ga0049111_10012893 | 3300003851 | Marine Gutless Worms Symbiont | CNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTASLNPLLGQQA* |
| Ga0049111_10016791 | 3300003851 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNFLLSQQA* |
| Ga0049112_10001131 | 3300003855 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLSFLIPPLYSLLGQQA* |
| Ga0049112_100020111 | 3300003855 | Marine Gutless Worms Symbiont | MFMVGDCYTQNVMMSDLSIAVALRLGFLTAPLYSLLGQQA* |
| Ga0049112_10002321 | 3300003855 | Marine Gutless Worms Symbiont | YGRSLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLGQQA* |
| Ga0049112_10002991 | 3300003855 | Marine Gutless Worms Symbiont | YTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQALDLSRLQ* |
| Ga0049112_10004571 | 3300003855 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCHTQSVMMSDLSIAVAPRLDSLTAPLYSLLG* |
| Ga0049112_10006477 | 3300003855 | Marine Gutless Worms Symbiont | RIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA* |
| Ga0049112_10008061 | 3300003855 | Marine Gutless Worms Symbiont | LCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA* |
| Ga0049112_10009931 | 3300003855 | Marine Gutless Worms Symbiont | WMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLTLLGQQA* |
| Ga0049112_10011441 | 3300003855 | Marine Gutless Worms Symbiont | GGVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLHVPFNSLLGQQA* |
| Ga0049112_10011621 | 3300003855 | Marine Gutless Worms Symbiont | GVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRFGFLTAPLYSLLGQQA* |
| Ga0049112_10013771 | 3300003855 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQV* |
| Ga0049112_10014581 | 3300003855 | Marine Gutless Worms Symbiont | FMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSPLGQQA* |
| Ga0049112_10015441 | 3300003855 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPQLDFLHAPFNSLLGQQA* |
| Ga0049112_10070991 | 3300003855 | Marine Gutless Worms Symbiont | CNWMFMVGDCYTQSVMMSDLSIAVALRTAPSIPYLGQQA* |
| Ga0049112_10112221 | 3300003855 | Marine Gutless Worms Symbiont | GVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRFDFLRAPFNSLFGQQA* |
| Ga0049112_10226741 | 3300003855 | Marine Gutless Worms Symbiont | CNWMFMVGDCYTQSVMMSDLSIAVALRHRPLNSLLGQQA* |
| JGI26667J51740_100000897 | 3300003906 | Marine Gutless Worms Symbiont | RMAGAARAFLCNWMFMVGDCYTQRVMMSDLSNAVVPWLDFLHAPFNSLLGQQA* |
| JGI26667J51740_100000901 | 3300003906 | Marine Gutless Worms Symbiont | FLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLLAPLDSLLGQQA* |
| JGI26667J51740_100001821 | 3300003906 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSFLGQQA* |
| JGI26667J51740_100002966 | 3300003906 | Marine Gutless Worms Symbiont | VVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFPRSLNSLLGQQA* |
| JGI26667J51740_100003087 | 3300003906 | Marine Gutless Worms Symbiont | GVVRAFLCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLPVPLNSLLGQQA* |
| JGI26667J51740_100003321 | 3300003906 | Marine Gutless Worms Symbiont | FMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNPYLGQQA* |
| JGI26667J51740_100004416 | 3300003906 | Marine Gutless Worms Symbiont | CNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHASFNSLLGQQA* |
| JGI26667J51740_100007935 | 3300003906 | Marine Gutless Worms Symbiont | MAGVVRAFLRNWMFMVGDCYTQSVVMSDLSNAVAPRLGFLHAPLNSLLGQQA* |
| JGI26667J51740_100021751 | 3300003906 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSPLGQQA* |
| JGI26667J51740_100027903 | 3300003906 | Marine Gutless Worms Symbiont | AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPQLDFLPAPLNSLLGQQA* |
| JGI26667J51740_100132591 | 3300003906 | Marine Gutless Worms Symbiont | AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLPAPFNSLLGQQA* |
| Ga0049105_10020521 | 3300004630 | Marine Gutless Worms Symbiont | AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPLLGFLHAPLNSLLGQQA* |
| Ga0049105_10022187 | 3300004630 | Marine Gutless Worms Symbiont | MAGAARAFLCNWMFMVGDCYTQRVMMSDLSNAVVPWLDFLHAPFNSLLGQQA* |
| Ga0049105_100438212 | 3300004630 | Marine Gutless Worms Symbiont | NSRRIAGVVRAFLCDWMFMVGDCYTQRVMMSDLSNAVAPRLGFLPAPLNSLLGQQA* |
| Ga0049105_100548211 | 3300004630 | Marine Gutless Worms Symbiont | NSRRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSFLGQQA* |
| Ga0049105_100613711 | 3300004630 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQRVIMSDLSNAVAPLLDFLHAPFNSLLGQQA* |
| Ga0049105_10081141 | 3300004630 | Marine Gutless Worms Symbiont | NSRRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPQLGFLPAPLNSLLGQQA* |
| Ga0049105_10100451 | 3300004630 | Marine Gutless Worms Symbiont | SRRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLGQQA* |
| Ga0049105_10109091 | 3300004630 | Marine Gutless Worms Symbiont | FLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNPYLGQQA* |
| Ga0049105_10111931 | 3300004630 | Marine Gutless Worms Symbiont | VVRAFLCNWMFMVGDCYTQSVMMSDLSNAAAPRLDFLHAPLDSLLGQQA* |
| Ga0049105_10160767 | 3300004630 | Marine Gutless Worms Symbiont | GVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHASFNSLLGQQA* |
| Ga0049105_10280657 | 3300004630 | Marine Gutless Worms Symbiont | RIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFFPAPLDSLLGQQA* |
| Ga0049105_10320406 | 3300004630 | Marine Gutless Worms Symbiont | FMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA* |
| Ga0049105_10359011 | 3300004630 | Marine Gutless Worms Symbiont | WMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA* |
| Ga0049105_10423401 | 3300004630 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAAAPRLGFFPAPLNSLLGQQA* |
| Ga0049105_10479893 | 3300004630 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNTVAPLLDFLHAPFNSLLGQQA* |
| Ga0049105_10485194 | 3300004630 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVASRLGFLHAPLDSLLGQQA* |
| Ga0049105_10645923 | 3300004630 | Marine Gutless Worms Symbiont | AGVVRAFLCDWMFMVGDCYLNRVMMSDLSNAVAPRLGFLHAPLDSLLGQQA* |
| Ga0049105_10782671 | 3300004630 | Marine Gutless Worms Symbiont | AFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA* |
| Ga0049105_10919201 | 3300004630 | Marine Gutless Worms Symbiont | CNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLG* |
| Ga0049105_10988604 | 3300004630 | Marine Gutless Worms Symbiont | LCNWMFMVGDCYTQRVMMSDLSNAAALRLGFLHAPLNSLLGQQA* |
| Ga0049105_11622783 | 3300004630 | Marine Gutless Worms Symbiont | CNSRRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLPAPFNSLLGQQA* |
| Ga0049105_11623102 | 3300004630 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVALRLDFLHAPFNSLLGQQA* |
| Ga0049105_11759393 | 3300004630 | Marine Gutless Worms Symbiont | LCNWMFMVGDCYTQRVMMSDLSNAAALRLGFLHAPLNSLLSQQA* |
| Ga0049105_11988171 | 3300004630 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNTVAPRLGFLPAPLNSLLGQQA* |
| Ga0049105_12272921 | 3300004630 | Marine Gutless Worms Symbiont | NSRRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPLLDFLHAPFNSLLGQQA* |
| Ga0049105_13052752 | 3300004630 | Marine Gutless Worms Symbiont | NSRRIAGVVRAFLCDWMFMVGDCYTQRVMMSDLSNAVAPQLGFLPAPLDSLLGQQA* |
| Ga0071327_10014297 | 3300005170 | Marine Gutless Worms Symbiont | NSRRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPLLGFLHAPLNSLLGQQA* |
| Ga0071327_10573711 | 3300005170 | Marine Gutless Worms Symbiont | AGVVRAFLCDWMFMGVIAILNRVMMSDLSNAVAPRLGFLHAPLDSLLGQQA* |
| Ga0071327_11574451 | 3300005170 | Marine Gutless Worms Symbiont | AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLLAPLDSLLGQQA* |
| Ga0056111_10010311 | 3300008214 | Marine Gutless Worms Symbiont | SRRIAGVVRAFLCNWMFMVGDCYTQRVMMSDLSNALAPRLDFLHAPFNSLLGQQA* |
| Ga0056111_10011545 | 3300008214 | Marine Gutless Worms Symbiont | GVVRAFLCNWMFMVGDCYTQRVMMSDLSNALAPRLGFLTAPFNSLFGQQA* |
| Ga0056111_10021853 | 3300008214 | Marine Gutless Worms Symbiont | MFMVGDCYTQKVMMSDLSNALAPRLDFLTAPLNSLLGQQA* |
| Ga0056111_10022901 | 3300008214 | Marine Gutless Worms Symbiont | FLCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLTAPLNSLPGQQA* |
| Ga0056111_10025173 | 3300008214 | Marine Gutless Worms Symbiont | VVRAFLCNWMFMVGDCYTQRVMMSDLSNALAPRLDFLHAPFNSLLGQQA* |
| Ga0056111_10029552 | 3300008214 | Marine Gutless Worms Symbiont | MFMVGDCYTQKVMMSDLSNAVAPRLGFLTAPLNSFLGQQA* |
| Ga0056111_10068782 | 3300008214 | Marine Gutless Worms Symbiont | LCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLTAPLNSLLDQQA* |
| Ga0056111_10095202 | 3300008214 | Marine Gutless Worms Symbiont | FMVGDCYTQRVMMSDLSNAVAPRLGFLTAPLNSLLGQQA* |
| Ga0209453_10000071 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPQLGFLTPPLYSLLGQQA |
| Ga0209453_10000459 | 3300027341 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVTPRLGFLTPPLYPLLGQQA |
| Ga0209453_100004915 | 3300027341 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA |
| Ga0209453_10000591 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVALRLGFLTAPLYSLLGQQA |
| Ga0209453_100006010 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLG |
| Ga0209453_10000602 | 3300027341 | Marine Gutless Worms Symbiont | MAGGVRAFLGNWMFMVGDCYTQSVMMSDLLNAVALRLDFLHAPFNSLLGQQA |
| Ga0209453_10000751 | 3300027341 | Marine Gutless Worms Symbiont | CNSRRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYSLLGQQA |
| Ga0209453_10000761 | 3300027341 | Marine Gutless Worms Symbiont | CNSRRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLTAPLYSLLGQQA |
| Ga0209453_100008612 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209453_10000951 | 3300027341 | Marine Gutless Worms Symbiont | AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQV |
| Ga0209453_10001001 | 3300027341 | Marine Gutless Worms Symbiont | FLCNWMFISVMMSDLSIAVAPRLGFLTPPLYSLLGQQA |
| Ga0209453_10001252 | 3300027341 | Marine Gutless Worms Symbiont | MVGDCYTQNVMMSDLSIAVALRLGFLTAPLYSLLGQQA |
| Ga0209453_100013611 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLVQQA |
| Ga0209453_10001371 | 3300027341 | Marine Gutless Worms Symbiont | DCNARRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209453_10001449 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQA |
| Ga0209453_100015910 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLNSLLGQQA |
| Ga0209453_10001592 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCCTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209453_100017012 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA |
| Ga0209453_100017911 | 3300027341 | Marine Gutless Worms Symbiont | AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA |
| Ga0209453_10001831 | 3300027341 | Marine Gutless Worms Symbiont | AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQALDLSRLQ |
| Ga0209453_10001915 | 3300027341 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209453_10002471 | 3300027341 | Marine Gutless Worms Symbiont | DCNARRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRFGFLTAPLYSLLGQQA |
| Ga0209453_10002497 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLDFLTAPLYSLLGQQA |
| Ga0209453_10002807 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYSLLGQQA |
| Ga0209453_10002892 | 3300027341 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA |
| Ga0209453_10003416 | 3300027341 | Marine Gutless Worms Symbiont | AGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209453_10004185 | 3300027341 | Marine Gutless Worms Symbiont | GDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA |
| Ga0209453_10006351 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVALRLGCLTAPLYSLLGQQA |
| Ga0209453_10008542 | 3300027341 | Marine Gutless Worms Symbiont | MGFFKAPYTQRVMMSDLSNAVAPQLGFLTAPLYSLLGQQA |
| Ga0209453_10010111 | 3300027341 | Marine Gutless Worms Symbiont | FMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209453_10012551 | 3300027341 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQT |
| Ga0209453_10026344 | 3300027341 | Marine Gutless Worms Symbiont | IAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTASLNPLLGQQA |
| Ga0209453_10060722 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYFLLGQQA |
| Ga0209453_10076091 | 3300027341 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLSQQA |
| Ga0209453_11405201 | 3300027341 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAIAPRLGFLTAPLYSLLGQQA |
| Ga0209049_100003531 | 3300027404 | Marine Gutless Worms Symbiont | IAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209049_10000663 | 3300027404 | Marine Gutless Worms Symbiont | MAGGVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLDQQA |
| Ga0209049_10001222 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVAPQLGCLTAPLYSLLGQQA |
| Ga0209049_10001415 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLLNAVALRLDFLHAPFNSLLGQQA |
| Ga0209049_100014313 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAIAPRLGFLTAPLYSLLGQQA |
| Ga0209049_10001521 | 3300027404 | Marine Gutless Worms Symbiont | RIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA |
| Ga0209049_10001551 | 3300027404 | Marine Gutless Worms Symbiont | GVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTVPLYSLLGQQA |
| Ga0209049_10001889 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVTPRLGFLTPPLYSLLGQQA |
| Ga0209049_10001961 | 3300027404 | Marine Gutless Worms Symbiont | RIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA |
| Ga0209049_10003157 | 3300027404 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRFDFLRAPFNSLFGQQA |
| Ga0209049_100034713 | 3300027404 | Marine Gutless Worms Symbiont | MFMVGDCHTQSVMMSDLSIAVAPRLGFLTPPLYSLLGQQA |
| Ga0209049_100035311 | 3300027404 | Marine Gutless Worms Symbiont | MFMVGDCYTQNVMMSDLSIAVALRLGFLTAPLYSLLGQQA |
| Ga0209049_10003971 | 3300027404 | Marine Gutless Worms Symbiont | NSRRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLDFLHAPFNSFLGQQA |
| Ga0209049_10004444 | 3300027404 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPQLDFLHAPFNSLLGQQA |
| Ga0209049_10005106 | 3300027404 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMPDLSIAVALRLGFLTAPLYSLLGQQA |
| Ga0209049_10006643 | 3300027404 | Marine Gutless Worms Symbiont | MAGGVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLDFLHVPFNSLLGQQA |
| Ga0209049_10006652 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVIVLDLPIVVAPRLGFLTAPLYSLLGQQA |
| Ga0209049_10009052 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSNAVAPQLDFLHAPFNSLLGQQA |
| Ga0209049_10011847 | 3300027404 | Marine Gutless Worms Symbiont | GGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLLYSLLGQQA |
| Ga0209049_10012622 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSIAVALRLGCLTAPLYSLLGQQA |
| Ga0209049_10017954 | 3300027404 | Marine Gutless Worms Symbiont | MSMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLGQQA |
| Ga0209049_10019326 | 3300027404 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQV |
| Ga0209049_10022136 | 3300027404 | Marine Gutless Worms Symbiont | GVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLGQQA |
| Ga0209049_10031265 | 3300027404 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSIAVAPRLGFLTASLNPLLGQQA |
| Ga0209049_10037133 | 3300027404 | Marine Gutless Worms Symbiont | RRIAGGVRAFLCNWMFMVGDCYTQSVMMSDLSIAVALRLGFLTAPLYSLLG |
| Ga0209049_10118213 | 3300027404 | Marine Gutless Worms Symbiont | GVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNFLLSQQA |
| Ga0209049_10255023 | 3300027404 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSNAVALRLDFLHAPFNSLLGQQA |
| Ga0209562_12497411 | 3300027519 | Marine Gutless Worms Symbiont | VRAFLCNWMFMVGDCYTQRVMMSDLSNAVAPRLGFLHAPFNSLLGQQA |
| Ga0209255_10000228 | 3300027550 | Marine Gutless Worms Symbiont | MVGDCYTQSVMMSDLSNAVALRLGFLPAPLNSLLGQQA |
| Ga0209255_10000781 | 3300027550 | Marine Gutless Worms Symbiont | AGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPFNSLLGQQA |
| Ga0209255_10001143 | 3300027550 | Marine Gutless Worms Symbiont | MVGDCYTKEVMMSDLSNAVAPRLGFLHAPLDSLLGQQA |
| Ga0209255_100013120 | 3300027550 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSLLGQQA |
| Ga0209255_10002452 | 3300027550 | Marine Gutless Worms Symbiont | MAGAARAFLCNWMFMVGDCYTQRVMMSDLSNAVVPWLDFLHAPFNSLLGQQA |
| Ga0209255_10002852 | 3300027550 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQRVIMSDLSNAVAPLLDFLHAPFNSLLGQQA |
| Ga0209255_10003881 | 3300027550 | Marine Gutless Worms Symbiont | RRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLDSLLGQQA |
| Ga0209255_100051610 | 3300027550 | Marine Gutless Worms Symbiont | RIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLLAPLDSLLGQQA |
| Ga0209255_10006089 | 3300027550 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPQLDFLPAPLNSLLGQQA |
| Ga0209255_10012311 | 3300027550 | Marine Gutless Worms Symbiont | CNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLNSLLGQQA |
| Ga0209255_100125210 | 3300027550 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSFLGQQA |
| Ga0209255_10013162 | 3300027550 | Marine Gutless Worms Symbiont | MVGDYYTQSVMMSDLSNAVAPRLGFLHAPFNSLLGQQA |
| Ga0209255_10015881 | 3300027550 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVALRLGFLHAPLNSLLGQQA |
| Ga0209255_10018501 | 3300027550 | Marine Gutless Worms Symbiont | RRIAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLGQQA |
| Ga0209255_10020019 | 3300027550 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNAVAPRLDFLHAPFNSLLGQQA |
| Ga0209255_10045177 | 3300027550 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHASFNSLLGQQA |
| Ga0209255_10103431 | 3300027550 | Marine Gutless Worms Symbiont | GVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLGQQA |
| Ga0209255_10483123 | 3300027550 | Marine Gutless Worms Symbiont | MAGVVRAFLCNWMFMVGDCYTQRVMMSDLSNAVAPQLGFLPAPLDSLLGQQA |
| Ga0209255_10696774 | 3300027550 | Marine Gutless Worms Symbiont | RRMAGVVRAFLCNWMFMVGDCYTQSVMMSDLSNAVAPRLGFLPAPLNSLLGQQA |
| Ga0209255_11614343 | 3300027550 | Marine Gutless Worms Symbiont | MFMVGDCYTQSVMMSDLSNTVAPRLGFLPAPLNSLLGQQA |
| Ga0209255_12466542 | 3300027550 | Marine Gutless Worms Symbiont | MAGVVRAFLCNRMFMVGDCYTKEVMMSDLSNAVAPRLGFLHAPLDSLLGQQA |
| Ga0209255_13672321 | 3300027550 | Marine Gutless Worms Symbiont | MVDDCYTQSVMMSDLSNAVAPRLGFLHAPLDSLLGQQA |
| ⦗Top⦘ |