Scaffold Ga0209021_1055877

Overview

Basic Information

• Taxon OID: 3300027386
• Scaffold ID: Ga0209021_1055877
• Source Dataset Name: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by freeze-thaw cycling (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 983
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Source Dataset Sampling Location

• Location Name: Gulf of Piran, Adriatic Sea
• Coordinates
  • Lat. (^o): 45.5099
  • Long. (^o): 13.56
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087322	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209021_10558772	F087322	N/A	LVLTPLLVLRITQAGTGEVCLVFLSRRIFLGDDLRAAIDFQAQKALFKPLDDMRNPLIF