Scaffold Ga0209453_1001011

Overview

Basic Information

• Taxon OID: 3300027341
• Scaffold ID: Ga0209453_1001011
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2689
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Germany: Marburg
• Coordinates
  • Lat. (^o): 50.8
  • Long. (^o): 8.81

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039940	Metagenome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209453_10010111	F039940	N/A	FMVGDCYTQSVMMSDLSIAVAPRLGFLTAPLYSLLGQQA