Scaffold Ga0208952_1011456

Overview

Basic Information

• Taxon OID: 3300027182
• Scaffold ID: Ga0208952_1011456
• Source Dataset Name: Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location

• Location Name: Harvard Forest, Massachusetts, USA
• Coordinates
  • Lat. (^o): 42.5502
  • Long. (^o): -72.1737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001931	Metagenome / Metatranscriptome	615	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208952_10114562	F001931	N/A	MMRGMPAEPIKDQRHHILSGVVDALLGDLKKGNGDRDRRRQVEEWMRTLAEKYPEFKIEVGLRDYYLAEAQRLRTEFDKAADLTEKLTLGRNIETFLDRAAEYERRITDR