Scaffold Ga0208955_100474

Overview

Basic Information

• Taxon OID: 3300027179
• Scaffold ID: Ga0208955_100474
• Source Dataset Name: Bulk soil microbial communities from Harvard Forest, USA - 2Bulk_unsorted metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location

• Location Name: Harvard Forest, Massachusetts, USA
• Coordinates
  • Lat. (^o): 42.5502
  • Long. (^o): -72.1737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103737	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208955_1004741	F103737	N/A	KQVLPFHGPVRFDRYLPASNKVSGRIVMGKDFDSQMGTGHKVYMNVGSNQGVKIGDFFRAVRSYEADLKDPVDSLSFRAAMAEDTQKKMPSFDPQLFEKENGPVIHVRDLPRRAIGEIVIIGVTDTTATGMIVFAMEDVHAGDGVELDQVN