NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255066_1041233

Scaffold Ga0255066_1041233


Overview

Basic Information
Taxon OID3300027131 Open in IMG/M
Scaffold IDGa0255066_1041233 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)646
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022862Metagenome / Metatranscriptome212N
F024782Metagenome / Metatranscriptome204Y
F102699Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0255066_10412331F022862N/AKFKDVDIIMSLRYYSYTSSALEMKFTPQQIELLIKTRDEIRDLTEKQHKLYDILIKELNVSVYAEDWLFDYIYNECGSVEDLENRM
Ga0255066_10412332F102699N/AMNHQPSFYLSLDLPKNFTREDAEKIQKDILDFLEGKRHYGAKYDGKNGITVKIVSVSTNH
Ga0255066_10412333F024782N/AMIEKAIERLRAYNDWRTGKDDRTMDEAGIQPSQLTVDIKTVCDELEKLISM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.