Scaffold Ga0207831_100060

Overview

Basic Information

• Taxon OID: 3300026968
• Scaffold ID: Ga0207831_100060
• Source Dataset Name: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 183421
• Total Scaffold Genes: 167
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 137 (82.04%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Bioluminescent Bay, La Paraguera, Puerto Rico
• Coordinates
  • Lat. (^o): 17.967317
  • Long. (^o): -67.018833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023595	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207831_10006066	F023595	N/A	MVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI