NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207831_100023

Scaffold Ga0207831_100023


Overview

Basic Information
Taxon OID3300026968 Open in IMG/M
Scaffold IDGa0207831_100023 Open in IMG/M
Source Dataset NameAerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)385056
Total Scaffold Genes353 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)308 (87.25%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location NameBioluminescent Bay, La Paraguera, Puerto Rico
CoordinatesLat. (o)17.967317Long. (o)-67.018833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023595Metagenome / Metatranscriptome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0207831_100023301F023595N/AMVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.