NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256878_1050492

Scaffold Ga0256878_1050492


Overview

Basic Information
Taxon OID3300026913 Open in IMG/M
Scaffold IDGa0256878_1050492 Open in IMG/M
Source Dataset NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0436-MT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)685
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0256878_10504921F034190N/AKHSRAAGQQPLLTIPPERIVPTPLHLFLGISNRIILDAFSALLGKERVEAAVKSITTVHSAGCSGAADLHDLNGPEISKWIKKECSATLLSAAKASSLVPAATAASHSILSRWLQQLQHCLLRSGDWSSDEIEAWRSVVSDIHQHWCAETSQAAFPKLHMLHHSVDFAERHRFLGRASEAQIESFHAAFNALFHKQHRNQLGNTAERLRRCLADASLRAVQPFVLPPS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.