3300026913: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0436-MT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300026913
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114432 | Gp0296254 | Ga0256878
• Sample Name: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0436-MT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118764817
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034190	Metagenome / Metatranscriptome	175	Y
F041209	Metagenome / Metatranscriptome	160	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256878_1003828	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	3004
Ga0256878_1050492	Not Available	685

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256878_1003828	Ga0256878_10038282	F041209	LNTLRLSAAPSHTIVLPGEQAYVLATETSAYAKRYDMIAVCAGDRVLLPKIFSPKERAGAEVKGINRSMLLQFIDDVLAQAVEGLDRYPLTLVLDRATIHMDLDAIRQAFRDRGSEAISDILLMPPNAAKRLSPLDNSLFHDWKEECRRHCPATAKTIERIMSDAWEKLKPGPHYLHCGLTRSKDVYFDCPAPAKHKHAS
Ga0256878_1050492	Ga0256878_10504921	F034190	KHSRAAGQQPLLTIPPERIVPTPLHLFLGISNRIILDAFSALLGKERVEAAVKSITTVHSAGCSGAADLHDLNGPEISKWIKKECSATLLSAAKASSLVPAATAASHSILSRWLQQLQHCLLRSGDWSSDEIEAWRSVVSDIHQHWCAETSQAAFPKLHMLHHSVDFAERHRFLGRASEAQIESFHAAFNALFHKQHRNQLGNTAERLRRCLADASLRAVQPFVLPPS