Scaffold Ga0209902_102680

Overview

Basic Information

• Taxon OID: 3300026863
• Scaffold ID: Ga0209902_102680
• Source Dataset Name: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4665
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.9313884
  • Long. (^o): -122.0239394

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098177	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209902_1026807	F098177	AGGA	MSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK