NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209909_101775

Scaffold Ga0209909_101775


Overview

Basic Information
Taxon OID3300026825 Open in IMG/M
Scaffold IDGa0209909_101775 Open in IMG/M
Source Dataset NameCyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2997
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.9313884Long. (o)-122.0239394Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066275Metagenome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0209909_1017752F066275AGGAGGVNEAHFREIEKVLLYVSEARRKAERVAESIERDGAEPHLVAALRDAERDLAELHRRLMHGTYWAVPKEQLALVPEDGPGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.