| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026825 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110132 | Gp0095971 | Ga0209909 |
| Sample Name | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 82345343 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 4 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 37.9313884 | Long. (o) | -122.0239394 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053413 | Metagenome / Metatranscriptome | 141 | Y |
| F066275 | Metagenome | 127 | Y |
| F080441 | Metagenome / Metatranscriptome | 115 | Y |
| F089171 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209909_100254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 58264 | Open in IMG/M |
| Ga0209909_100296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 47544 | Open in IMG/M |
| Ga0209909_100399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 30300 | Open in IMG/M |
| Ga0209909_100437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 26723 | Open in IMG/M |
| Ga0209909_101775 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209909_100254 | Ga0209909_10025455 | F089171 | MSSKSIPLGAQEREILQAIARTTARSGAAVPLSSTQRLRFEMLGLIEDRADGVRLTERGRAVAAAPAEAPPVTRELQPATPRDRRGRRLGLRRRSPF |
| Ga0209909_100296 | Ga0209909_1002964 | F053413 | MFLSPLRERLGEGVNADVSSCITPSPSLSPKGERSMNSLR |
| Ga0209909_100399 | Ga0209909_1003995 | F053413 | MLLSPLGERLGEGVMQETVFALTPSPNLSPKGERNMRG |
| Ga0209909_100437 | Ga0209909_10043725 | F080441 | MLALGGCAVVNSAPSSQEVVQLRDVRDQCLMQNAIRLDDGRSDPQAIAASVVAACQSENQALITAIAGPDGFRQSEIARQIQQNSQQAATQYVLQVRAARTRS |
| Ga0209909_101775 | Ga0209909_1017752 | F066275 | VNEAHFREIEKVLLYVSEARRKAERVAESIERDGAEPHLVAALRDAERDLAELHRRLMHGTYWAVPKEQLALVPEDGPGR |
| ⦗Top⦘ |