| Basic Information | |
|---|---|
| Taxon OID | 3300026825 Open in IMG/M |
| Scaffold ID | Ga0209909_100399 Open in IMG/M |
| Source Dataset Name | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 30300 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 27 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.9313884 | Long. (o) | -122.0239394 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053413 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209909_1003995 | F053413 | AGTAG | MLLSPLGERLGEGVMQETVFALTPSPNLSPKGERNMRG |
| ⦗Top⦘ |