NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207925_101270

Scaffold Ga0207925_101270


Overview

Basic Information
Taxon OID3300026706 Open in IMG/M
Scaffold IDGa0207925_101270 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN624 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameGorham, Kansas, USA
CoordinatesLat. (o)39.05Long. (o)-99.1Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008776Metagenome328Y

Sequences

Protein IDFamilyRBSSequence
Ga0207925_1012702F008776GAGMKIYLEDEETLEDDVNYGIADCRKRLRSRRSTLRAQHHPPKECSNGEVSPAAGRVGSYAEVLAVSMSQSSLSRLVECLLEPASTNTPSQEESKEREEAGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.