Scaffold Ga0208346_101193

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208346_101193

Scaffold Ga0208346_101193

Overview

Basic Information
Taxon OID	3300026694 Open in IMG/M
Scaffold ID	Ga0208346_101193 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN611 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	565
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location Name	Gorham, Kansas, USA
Coordinates	Lat. (^o)	39.05	Long. (^o)	-99.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007321	Metagenome / Metatranscriptome	353	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208346_1011931	F007321	AGGAGG	MRAQTVQTWIARHILVRRRLEHVCTSYLLFLMVVTRKHTLAEAARFAGLHTSQF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.