NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208574_100007

Scaffold Ga0208574_100007


Overview

Basic Information
Taxon OID3300026666 Open in IMG/M
Scaffold IDGa0208574_100007 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN351 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2665
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameChapel Hill, North Carolina, USA
CoordinatesLat. (o)35.913Long. (o)-79.056Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003877Metagenome / Metatranscriptome464Y

Sequences

Protein IDFamilyRBSSequence
Ga0208574_1000073F003877N/AVKEGLNKELAAGCLVTSALGRVSRAQLVHTTARNCAGDEGGPFGFGDQVADSKPPQAAAVKSRGGERCGKVGTMIPAGMVERGERKRTAAEASKFS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.