Scaffold Ga0256913_10587791

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256913_10587791

Scaffold Ga0256913_10587791

Overview

Basic Information
Taxon OID	3300026546 Open in IMG/M
Scaffold ID	Ga0256913_10587791 Open in IMG/M
Source Dataset Name	Deep-sea worm associated microbial mat communities from Axial Seamount, Juan de Fuca Ridge, Pacific Ocean - Axial_Mat
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	564
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Deep-Sea Worm Associated Microbial Mat → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean: Juan de Fuca Ridge
Coordinates	Lat. (^o)	45.9333	Long. (^o)	-130.0138	Alt. (m)		Depth (m)	1200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030888	Metagenome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256913_105877911	F030888	GGA	MNKFFNESDENREYKYKILIYPNITYSKDLRKDSYIIVLENMIKSLNKIRNDIHFTIINPTYLD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.