Basic Information | |
---|---|
Taxon OID | 3300026546 Open in IMG/M |
Scaffold ID | Ga0256913_10233659 Open in IMG/M |
Source Dataset Name | Deep-sea worm associated microbial mat communities from Axial Seamount, Juan de Fuca Ridge, Pacific Ocean - Axial_Mat |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1065 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Deep-Sea Worm Associated Microbial Mat → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean: Juan de Fuca Ridge | |||||||
Coordinates | Lat. (o) | 45.9333 | Long. (o) | -130.0138 | Alt. (m) | Depth (m) | 1200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024889 | Metagenome | 204 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256913_102336591 | F024889 | N/A | MNSITIGTSMIVGVAILYIFALSYVEGKIARQENEKLKKNIDKLDDKA |
⦗Top⦘ |