| Basic Information | |
|---|---|
| Taxon OID | 3300026533 Open in IMG/M |
| Scaffold ID | Ga0256826_1266604 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV79 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 556 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.8472 | Long. (o) | -104.2975 | Alt. (m) | Depth (m) | 2514 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025922 | Metagenome / Metatranscriptome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256826_12666041 | F025922 | N/A | RVQTLGSTASFTSEDIFELGSLDIIDAVDDTPNVSVTLNTNDFGDLGTLATLAQLSPAKKAMDATADATNANLQVVDAALAATGTFLHGACLSDFAVTCGSLTGVTLWAPVQDECSIGSLANNIDQTLFMDEVYVNSLEFSYSSGANATENYGAETDNKMWLLNDGRFVNYDKYVLDAGAVGDG |
| ⦗Top⦘ |