3300026533: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV79

Overview

Basic Information

• IMG/M Taxon OID: 3300026533
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046784 | Gp0296291 | Ga0256826
• Sample Name: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV79
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 612734278
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8472
  • Long. (^o): -104.2975
  • Alt. (m): N/A
  • Depth (m): 2514

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025922	Metagenome / Metatranscriptome	199	Y
F069354	Metagenome	124	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256826_1031959	All Organisms → Viruses → Predicted Viral	2407
Ga0256826_1266604	Not Available	556

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256826_1031959	Ga0256826_10319595	F069354	MKEFNLTRLMDSCCITINEEVYDELFDYLIEIDVDLNTLNIDDLVVNSLSYIDKDEGIDEDNVYVLKEADDGFYILE
Ga0256826_1266604	Ga0256826_12666041	F025922	RVQTLGSTASFTSEDIFELGSLDIIDAVDDTPNVSVTLNTNDFGDLGTLATLAQLSPAKKAMDATADATNANLQVVDAALAATGTFLHGACLSDFAVTCGSLTGVTLWAPVQDECSIGSLANNIDQTLFMDEVYVNSLEFSYSSGANATENYGAETDNKMWLLNDGRFVNYDKYVLDAGAVGDG