Scaffold Ga0256835_1013012

Overview

Basic Information

• Taxon OID: 3300026531
• Scaffold ID: Ga0256835_1013012
• Source Dataset Name: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - PIR-30
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3785
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.775
  • Long. (^o): -104.2801
  • Depth (m): 2513

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052283	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256835_10130123	F052283	AGGAGG	MTAKQKSLVIGAIIGAMLGALGGYLFGRGAEAARERGSGVLSLKSVPAGEVVRLFIAVMAVLRGIAELGERL