Scaffold Ga0213910_100225

Overview

Basic Information

• Taxon OID: 3300026380
• Scaffold ID: Ga0213910_100225
• Source Dataset Name: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0909-MT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3901
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae → unclassified Fiersviridae → Leviviridae sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030638	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213910_1002253	F030638	AGGAG	MAAAADLTLKNNAAANVTFSVYSVNPDSVEWVESGATTILGMSRFVLSRVIPADKAAGVYRTRGKLTRPIVNGTSGLLDGTLTATFEILRPAKLTIADTDELVARFKEAVAQAIVKTAAESGAIPT