 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300026235 Open in IMG/M |
| Scaffold ID | Ga0209649_1001298 Open in IMG/M |
| Source Dataset Name | Upper troposphere microbial communities from Midwestern USA - DC3-114 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1074 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Midwestern USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080164 | Metagenome | 115 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209649_10012982 | F080164 | N/A | MRPTSFVLSLLLGMVGLALCAAPQVTLRERASAFPLITEKDESEIIAPYAWRLPVVPLSLDNREIRNFAKYPALPSLSEGKLTVRVLVVGDTVAVHQDLMDDFAKRCRTTLGFGVRTAPKLFGIKGMHVYGVQKDGSRQAVDEQVTLHLPGFEKAEKPLHYKEQTGQLVLCEYYGSHRGDLLLNAANARPEIFGELCPVVDFHFPVELRRAYAWLLLEIELEDGTKLSTSLQHYDEQTSILDHPDRS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |