Scaffold Ga0209351_107631

Overview

Basic Information

• Taxon OID: 3300026230
• Scaffold ID: Ga0209351_107631
• Source Dataset Name: Upper troposphere microbial communities from Colorado-Nebraska, USA - DC3-106 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 528
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location

• Location Name: Midwestern USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010914	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209351_1076312	F010914	AGG	MIYNILTEQNGKFVDSGETVECEFEETQAVIDELQLERGCCCALEAVSE