Basic Information | |
---|---|
IMG/M Taxon OID | 3300026230 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085201 | Ga0209351 |
Sample Name | Upper troposphere microbial communities from Colorado-Nebraska, USA - DC3-106 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 38200586 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Type | Environmental |
Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Midwestern USA | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010914 | Metagenome / Metatranscriptome | 297 | Y |
F028669 | Metagenome | 190 | Y |
F045749 | Metagenome / Metatranscriptome | 152 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209351_104802 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia | 666 | Open in IMG/M |
Ga0209351_106658 | Not Available | 565 | Open in IMG/M |
Ga0209351_107631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila | 528 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209351_104802 | Ga0209351_1048021 | F028669 | MYARPEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVRGKGRRATEKIERSK |
Ga0209351_106658 | Ga0209351_1066581 | F045749 | FFGGREQTADYFENLFAESEKHAGGIKSFLLNYKISDEFKASGRAPDTSSRQAMIQATISPEQCTVEDLINKNECLIINGRVLDVTWLNELCVIDGDMLPPTRTLGHILSDMGYSQIEGRSVKIQKTRENHYIWFKNVAGVASSDVIEQVRDFFKKGLDEVPF |
Ga0209351_107631 | Ga0209351_1076312 | F010914 | MIYNILTEQNGKFVDSGETVECEFEETQAVIDELQLERGCCCALEAVSE |
⦗Top⦘ |