NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026230

3300026230: Upper troposphere microbial communities from Colorado-Nebraska, USA - DC3-106 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026230 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085201 | Ga0209351
Sample NameUpper troposphere microbial communities from Colorado-Nebraska, USA - DC3-106 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size38200586
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationMidwestern USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010914Metagenome / Metatranscriptome297Y
F028669Metagenome190Y
F045749Metagenome / Metatranscriptome152Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209351_104802All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia666Open in IMG/M
Ga0209351_106658Not Available565Open in IMG/M
Ga0209351_107631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caldimonas → Caldimonas tepidiphila528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209351_104802Ga0209351_1048021F028669MYARPEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVRGKGRRATEKIERSK
Ga0209351_106658Ga0209351_1066581F045749FFGGREQTADYFENLFAESEKHAGGIKSFLLNYKISDEFKASGRAPDTSSRQAMIQATISPEQCTVEDLINKNECLIINGRVLDVTWLNELCVIDGDMLPPTRTLGHILSDMGYSQIEGRSVKIQKTRENHYIWFKNVAGVASSDVIEQVRDFFKKGLDEVPF
Ga0209351_107631Ga0209351_1076312F010914MIYNILTEQNGKFVDSGETVECEFEETQAVIDELQLERGCCCALEAVSE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.