NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209312_1048066

Scaffold Ga0209312_1048066


Overview

Basic Information
Taxon OID3300026195 Open in IMG/M
Scaffold IDGa0209312_1048066 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1271
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → Syntrophomonas → Syntrophomonas wolfei(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103105Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209312_10480661F103105AGGAGGMIPAPYDTCPVVMSRNKAAKLLGVDRKTLAKNKALLDRCSEKIGDKPKVIRD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.