| Basic Information | |
|---|---|
| Taxon OID | 3300026148 Open in IMG/M |
| Scaffold ID | Ga0265583_12479 Open in IMG/M |
| Source Dataset Name | Rock biofilm microbial communities from Utah desert near Hanksville, Utah, USA - GBS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2352 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Desert → Rock Biofilm → Utah Desert Microbiome From Environmental Samples Near Hanksville, Utah, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hanksville, UT, USA | |||||||
| Coordinates | Lat. (o) | 38.41627709 | Long. (o) | -110.78444637 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093266 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265583_124792 | F093266 | GGA | MEARVEALMENLAMAVMQADHLAADAPEYEVLAETLAYALDLADLGLSAESGAFG |
| ⦗Top⦘ |