3300026148: Rock biofilm microbial communities from Utah desert near Hanksville, Utah, USA - GBS

Overview

Basic Information

• IMG/M Taxon OID: 3300026148
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0134256 | Gp0306302 | Ga0265583
• Sample Name: Rock biofilm microbial communities from Utah desert near Hanksville, Utah, USA - GBS
• Sequencing Status: Permanent Draft
• Sequencing Center: McGill University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7342719
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Utah Desert Microbiome From Environmental Samples Near Hanksville, Utah, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Desert → Rock Biofilm → Utah Desert Microbiome From Environmental Samples Near Hanksville, Utah, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): desert biome → endolithic environment → biofilm material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Surface (non-saline)

Location Information

• Location: Hanksville, UT, USA
• Coordinates
  • Lat. (^o): 38.41627709
  • Long. (^o): -110.78444637
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093266	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0265583_12479	Not Available	2352

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0265583_12479	Ga0265583_124792	F093266	MEARVEALMENLAMAVMQADHLAADAPEYEVLAETLAYALDLADLGLSAESGAFG