Scaffold Ga0209956_1009152

Overview

Basic Information

• Taxon OID: 3300026127
• Scaffold ID: Ga0209956_1009152
• Source Dataset Name: Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2012
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4965
  • Long. (^o): -122.1329
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027211	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209956_10091522	F027211	GAGG	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGQVG