Scaffold Ga0207962_1002049

Overview

Basic Information

• Taxon OID: 3300026091
• Scaffold ID: Ga0207962_1002049
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6767
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105335	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207962_10020497	F105335	N/A	RVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQAPGQIVAGKTGQLLKLPKP