NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207690_10786147

Scaffold Ga0207690_10786147


Overview

Basic Information
Taxon OID3300025932 Open in IMG/M
Scaffold IDGa0207690_10786147 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)786
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002111Metagenome / Metatranscriptome592Y
F007262Metagenome / Metatranscriptome354Y
F066970Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0207690_107861471F007262N/AYPVDSFGGWTSEAARPATGFFLLFTAIVVGFAVALIVGHIVWGQKF
Ga0207690_107861472F002111GGGGGMAVASVLPFVSYSSMTETLIPAAEWPTVYSSLQALKGHVQEYPGCQGFDVFVRAEGDGDVLVHCYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPGRSLVMEKVF
Ga0207690_107861474F066970AGGVYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.