| Basic Information | |
|---|---|
| Family ID | F066970 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MWVKHLSSLQFLTYVAFFAVVVAAICRFVPGKAAPVRQEP |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.40 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 7.94 |
| PF00115 | COX1 | 5.56 |
| PF00486 | Trans_reg_C | 0.79 |
| PF00589 | Phage_integrase | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101855833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300000443|F12B_10098612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
| 3300001686|C688J18823_10287882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300003321|soilH1_10365122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1276 | Open in IMG/M |
| 3300004156|Ga0062589_100343633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1180 | Open in IMG/M |
| 3300005175|Ga0066673_10733724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300005176|Ga0066679_10187430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
| 3300005187|Ga0066675_10071793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2204 | Open in IMG/M |
| 3300005187|Ga0066675_11360656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300005356|Ga0070674_101986870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300005451|Ga0066681_10954452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300005467|Ga0070706_101528999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300005536|Ga0070697_101516667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300005552|Ga0066701_10524240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300005614|Ga0068856_102555455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300005615|Ga0070702_101537547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300006175|Ga0070712_101438766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300006581|Ga0074048_12149685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2978 | Open in IMG/M |
| 3300006806|Ga0079220_10819946 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009012|Ga0066710_101775068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
| 3300009101|Ga0105247_11520050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300009137|Ga0066709_101728135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300009137|Ga0066709_103340771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300009545|Ga0105237_11490403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300010147|Ga0126319_1246827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4348 | Open in IMG/M |
| 3300010147|Ga0126319_1525713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
| 3300010320|Ga0134109_10177711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300010325|Ga0134064_10403983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300010326|Ga0134065_10367771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300010329|Ga0134111_10484818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300010335|Ga0134063_10328386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300010336|Ga0134071_10663197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300010364|Ga0134066_10272583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300010375|Ga0105239_10443901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1471 | Open in IMG/M |
| 3300010396|Ga0134126_11487233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300011003|Ga0138514_100016661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
| 3300012198|Ga0137364_10772933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300012201|Ga0137365_10485421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
| 3300012201|Ga0137365_10562247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300012204|Ga0137374_10074292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3330 | Open in IMG/M |
| 3300012208|Ga0137376_11182178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300012208|Ga0137376_11353250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300012285|Ga0137370_10011331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4270 | Open in IMG/M |
| 3300012285|Ga0137370_10366309 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300012285|Ga0137370_10922104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300012349|Ga0137387_11144168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300012353|Ga0137367_10320738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300012353|Ga0137367_10927922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300012359|Ga0137385_10419919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
| 3300012359|Ga0137385_10688176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300012361|Ga0137360_10858882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300012683|Ga0137398_10888111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300012891|Ga0157305_10186295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300012896|Ga0157303_10276229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012922|Ga0137394_11513004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300012923|Ga0137359_11311746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300012927|Ga0137416_10990108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300012929|Ga0137404_11830406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300012961|Ga0164302_11677581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300012977|Ga0134087_10110744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
| 3300012977|Ga0134087_10687288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300013308|Ga0157375_12871563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300014056|Ga0120125_1150587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300014058|Ga0120149_1156866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300014166|Ga0134079_10013230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2548 | Open in IMG/M |
| 3300014497|Ga0182008_10605440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300015357|Ga0134072_10017570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
| 3300018061|Ga0184619_10246312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300018061|Ga0184619_10421498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300018071|Ga0184618_10152544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300018075|Ga0184632_10427270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300018433|Ga0066667_10621124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300018433|Ga0066667_11903149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300018468|Ga0066662_11638897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300018482|Ga0066669_10409738 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300018482|Ga0066669_11885568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300019255|Ga0184643_1010922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300019255|Ga0184643_1232664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300019361|Ga0173482_10693880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300019362|Ga0173479_10602967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300019887|Ga0193729_1225827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300019890|Ga0193728_1344267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300020170|Ga0179594_10251958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300021363|Ga0193699_10319254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300021445|Ga0182009_10340319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300022534|Ga0224452_1018907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1902 | Open in IMG/M |
| 3300022756|Ga0222622_10022382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3241 | Open in IMG/M |
| 3300022915|Ga0247790_10005085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2545 | Open in IMG/M |
| 3300025885|Ga0207653_10261387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300025909|Ga0207705_10150224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
| 3300025910|Ga0207684_10506887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300025922|Ga0207646_11815429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300025932|Ga0207690_10786147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300025935|Ga0207709_10705649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300025972|Ga0207668_10787792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300026088|Ga0207641_11720595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300026322|Ga0209687_1239941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300026523|Ga0209808_1288897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300027882|Ga0209590_10647712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300028708|Ga0307295_10029272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
| 3300028711|Ga0307293_10140209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300028713|Ga0307303_10185388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300028716|Ga0307311_10021549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1606 | Open in IMG/M |
| 3300028717|Ga0307298_10013040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2099 | Open in IMG/M |
| 3300028719|Ga0307301_10067165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1115 | Open in IMG/M |
| 3300028719|Ga0307301_10227518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300028720|Ga0307317_10065734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
| 3300028754|Ga0307297_10006869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2889 | Open in IMG/M |
| 3300028784|Ga0307282_10147488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300028784|Ga0307282_10152786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300028784|Ga0307282_10365378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300028784|Ga0307282_10441970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300028802|Ga0307503_10518817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300028807|Ga0307305_10332434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300028811|Ga0307292_10351396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300028819|Ga0307296_10441783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300028824|Ga0307310_10593963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300028824|Ga0307310_10661738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300028828|Ga0307312_10551029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300028884|Ga0307308_10016884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3321 | Open in IMG/M |
| 3300028885|Ga0307304_10007137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3422 | Open in IMG/M |
| 3300028885|Ga0307304_10108636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
| 3300028885|Ga0307304_10428300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300031096|Ga0308193_1000507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2905 | Open in IMG/M |
| 3300031716|Ga0310813_11912532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300033412|Ga0310810_10090338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3670 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.59% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.79% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1018558334 | 3300000364 | Soil | VYLKHLTSLQFLTYLSFFAVVLAALFRFVPGRAPPVR |
| F12B_100986121 | 3300000443 | Soil | VYLKHLSSLQFLTYVAFLAVALAAIWRLIPGKAPPVRTEPYSDDELGAH |
| C688J18823_102878821 | 3300001686 | Soil | MWVQHLTSLQFLTYVGFFAVVVAAVMRFLPGAPAPARTEPYGEEEL |
| soilH1_103651221 | 3300003321 | Sugarcane Root And Bulk Soil | VWVQQLSSLDFLFYAAFFGVVVAAICYAVPGKAPPLREEPYPPEELGRHDARLAK |
| Ga0062589_1003436331 | 3300004156 | Soil | MWVKHLTSLQFLTYVAFFAVVVAAVMRFLPGAPAPARTEPYGEE |
| Ga0066673_107337241 | 3300005175 | Soil | VYLKHLTSLQFLTYVAFAAVALAAIMRMIPGRTPPARTEPYGHAELRDHDR |
| Ga0066679_101874301 | 3300005176 | Soil | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYPEDELYA |
| Ga0066675_100717931 | 3300005187 | Soil | LYVKHLTSLQFLTYVAFFAVVLAAMFKFVPGKAPPTRDEPYPEDEL |
| Ga0066675_113606563 | 3300005187 | Soil | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYP |
| Ga0070674_1019868703 | 3300005356 | Miscanthus Rhizosphere | LYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEP |
| Ga0066681_109544521 | 3300005451 | Soil | LYVKHLTSLQFLTYVAFFAVVLAAMFKFVPGKAPPTRDEP |
| Ga0070706_1015289991 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKASPVRDTPYPDDE |
| Ga0070697_1015166673 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGRATPVRDTPYPDEE |
| Ga0066701_105242401 | 3300005552 | Soil | VWVQHLSSLQFLTYVAFFAVVVGIVVTVVPGREPP |
| Ga0068856_1025554551 | 3300005614 | Corn Rhizosphere | VYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTR |
| Ga0070702_1015375473 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVKHLSSLQFLTYVAFFAVVIAAICKFVPGRAPPVREEPYPDE |
| Ga0070712_1014387663 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VYVKHLTSLQFLTYVAFFAVVIAAMFRFIPGKAPPVRTERYSEDEL |
| Ga0074048_121496851 | 3300006581 | Soil | MWVQHLSSLQFLTYVAFFAVVIAAICRFVPGRAPPVRETPYPDEEL |
| Ga0079220_108199462 | 3300006806 | Agricultural Soil | MWVKHLSSLQFLTYVAFFAVGIAAICKFVPGKAAPVR* |
| Ga0066710_1017750681 | 3300009012 | Grasslands Soil | LYLRHLSSLQFLTYAAFFAVVIAAIVRFLPGVAPPVRTEPYDDDELG |
| Ga0105247_115200501 | 3300009101 | Switchgrass Rhizosphere | VYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPYSDEELYA |
| Ga0066709_1017281354 | 3300009137 | Grasslands Soil | MWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTEPYGEQELAR |
| Ga0066709_1033407713 | 3300009137 | Grasslands Soil | VYVKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEPYPED |
| Ga0105237_114904031 | 3300009545 | Corn Rhizosphere | LYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEPYPEDELGAHD |
| Ga0126319_12468277 | 3300010147 | Soil | MWIKHLSSLQFLTYVAFFGVVVAAVFEFMPGRSPPLRREPYPE |
| Ga0126319_15257136 | 3300010147 | Soil | VYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPVREVPYPDEELHAH |
| Ga0134109_101777113 | 3300010320 | Grasslands Soil | LYVKHLTSLQFLTYVAFFAVVLGAMFRFVPGKAPPVRREPYPE |
| Ga0134064_104039833 | 3300010325 | Grasslands Soil | VYVKHLTSLQFLTYVAFFSVVIAAIFKFMPGKAPPVRT |
| Ga0134065_103677712 | 3300010326 | Grasslands Soil | MWVRHLSSLQFLTYVAFFAVVIAAIAKFVPGRSPPVREEPYPDEELHAHD |
| Ga0134111_104848181 | 3300010329 | Grasslands Soil | MWIKHLSSLQFLTYVAFFGVVITAICRFVPGRAPPLREEPYP |
| Ga0134063_103283864 | 3300010335 | Grasslands Soil | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPV |
| Ga0134071_106631973 | 3300010336 | Grasslands Soil | MWIKHPSSLQFLTYVAFFAVVVAAICKFVPGRAAPVRDTPYPDDELHAH |
| Ga0134066_102725831 | 3300010364 | Grasslands Soil | MWVKHLSSLQFLTYVAFFAVVIAGICRFVPGRAAPVREEPYPDEEL |
| Ga0105239_104439011 | 3300010375 | Corn Rhizosphere | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEPYPEDELGAHD |
| Ga0134126_114872331 | 3300010396 | Terrestrial Soil | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRS |
| Ga0138514_1000166615 | 3300011003 | Soil | VYVKHLTSLQFLTYVAFFAVVLSAMFKFVPGKAPPVRTDPY |
| Ga0137364_107729333 | 3300012198 | Vadose Zone Soil | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVR |
| Ga0137365_104854214 | 3300012201 | Vadose Zone Soil | VWIRHLSSLQFLTYVAFFAIVIASIVTIVPGRAPPLRRESYPDDELGR |
| Ga0137365_105622471 | 3300012201 | Vadose Zone Soil | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYPDEELYAH |
| Ga0137374_100742921 | 3300012204 | Vadose Zone Soil | VYLKHLTSLQFLTYVGFFTVLLAVLWRLLPGKTPPLRTEPFLEEKL |
| Ga0137376_111821783 | 3300012208 | Vadose Zone Soil | MWIKHLSSLQFLTYVAFFAVVVAAICKFVPGRAAPVRDTPYPDDELHAHDRKT |
| Ga0137376_113532503 | 3300012208 | Vadose Zone Soil | MYLRHLSSLQFLTYASFFGVVIAAMFRFMPGKAPPVRTEP |
| Ga0137370_100113311 | 3300012285 | Vadose Zone Soil | MWVRHLTSLQFLTYVAFFAVVIAAVMRFLPGAPAPVRTEPYDEEELGRHDRR |
| Ga0137370_103663092 | 3300012285 | Vadose Zone Soil | MWVQHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYPEDELYAHDRKT |
| Ga0137370_109221043 | 3300012285 | Vadose Zone Soil | VYLRHLSSLQFLTYASFFAVVVAALFRFLPGKKPPLRYEPYTDEELGA |
| Ga0137387_111441683 | 3300012349 | Vadose Zone Soil | VYVRHLTSLQFLTYVAFFAVVIAAMFRFVPGKTPPVRTEPYSEDEL |
| Ga0137367_103207381 | 3300012353 | Vadose Zone Soil | VYLKHLSSLQFLTYAAFFGVVVAALIRFLPGRAPP |
| Ga0137367_109279221 | 3300012353 | Vadose Zone Soil | MWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAP |
| Ga0137385_104199195 | 3300012359 | Vadose Zone Soil | LYVRHLTSLQFLTYVAFFAVVIAAMFRFVPGKAPQVRTEPYSEDELGAHDR |
| Ga0137385_106881761 | 3300012359 | Vadose Zone Soil | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEP* |
| Ga0137360_108588824 | 3300012361 | Vadose Zone Soil | MWVQHLSSLDFLTYVAFFGVVVAVICRFAPGKAAPVRTEPYSEDELARH |
| Ga0137398_108881111 | 3300012683 | Vadose Zone Soil | MWVQHLSSLDFLTYVAFFAVVVAAICRFVPGKAAPVRDEPFP |
| Ga0157305_101862953 | 3300012891 | Soil | VYLKHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPATRD |
| Ga0157303_102762293 | 3300012896 | Soil | VYVKHLTSLQFLTYVSFFAVVLAAVFRFVPGRSPPVRETPFPDDELY |
| Ga0137394_115130043 | 3300012922 | Vadose Zone Soil | MWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEPYSED |
| Ga0137359_113117463 | 3300012923 | Vadose Zone Soil | LYVRHLTSLQFLTYVGFFAVVLAAMLRFVPGKAPPTRDEPYLED |
| Ga0137416_109901084 | 3300012927 | Vadose Zone Soil | VWIRHLSSLQFLTYVAFFAIVVASIVTIVPGRAPPLREEPY |
| Ga0137404_118304061 | 3300012929 | Vadose Zone Soil | MWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEPYSEDELA |
| Ga0164302_116775811 | 3300012961 | Soil | LYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEPYPEDELGAH |
| Ga0134087_101107441 | 3300012977 | Grasslands Soil | MWVRHLSSLQFLTYVAFFAVVIAAIAKFVPGRSPPVREEPYPDEEL |
| Ga0134087_106872883 | 3300012977 | Grasslands Soil | MWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTEPYGEQELARHDG |
| Ga0157375_128715631 | 3300013308 | Miscanthus Rhizosphere | VYVKHVTSLQFLTYLSFFAVLVAAMFRFVPGRTPPARTVP |
| Ga0120125_11505871 | 3300014056 | Permafrost | LYVKHLTSLQFLTYVGFFTVVLAAMFKFVPGKAPPVRTEPYSEDEL |
| Ga0120149_11568663 | 3300014058 | Permafrost | LYVQHLSSLQFLTYVAFFAVVIAAIAKFVPGRAAPVREEP |
| Ga0134079_100132301 | 3300014166 | Grasslands Soil | MWVRHLTSLQFLTYVAFFAVVVAAVMRFLPGAPAPARTEP |
| Ga0182008_106054401 | 3300014497 | Rhizosphere | MWVKHLSSLQFLTYVAFFAVVVAAICRFVPGKASPV |
| Ga0134072_100175706 | 3300015357 | Grasslands Soil | LYVKHLTSLQFLTYVAFFAVVLAAMFKFVPGKAPPTRDEPYP |
| Ga0184619_102463124 | 3300018061 | Groundwater Sediment | MWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEPYSEDELARH |
| Ga0184619_104214983 | 3300018061 | Groundwater Sediment | VYVQHLSSLQFLTYVAFFTVVVAAICKFVPGRAAPVRDTPYPDEE |
| Ga0184618_101525444 | 3300018071 | Groundwater Sediment | MWVKHLSSFQFLTYVAFFAVVVAAICKFVPGKAAPVRET |
| Ga0184632_104272701 | 3300018075 | Groundwater Sediment | VYLKHLSSLQFLTYVAFLVVALAAIWRLVPGKAPPVRTE |
| Ga0066667_106211244 | 3300018433 | Grasslands Soil | MYLRHLSTLQFVTYASFFGVVVAALFRFLPGKKPPVRLEPYPEAELV |
| Ga0066667_119031493 | 3300018433 | Grasslands Soil | VYLRHLSTLQFVTYASFFGVVVAALFRFLPGKKPPLPLE |
| Ga0066662_116388971 | 3300018468 | Grasslands Soil | VWVKHLSSLQFLTYVAFFAVVVAAICKFVPGRAAP |
| Ga0066669_104097382 | 3300018482 | Grasslands Soil | MWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTER |
| Ga0066669_118855683 | 3300018482 | Grasslands Soil | MWIKHLSSLQFLTYVAFFGVVVAAICKFVPGRAAPVRDTPYPDD |
| Ga0184643_10109224 | 3300019255 | Groundwater Sediment | VYVKHLTSLQFLTYVAFFTVVLAAMFKFVPGKAPPVRTEPYSEDELGAH |
| Ga0184643_12326641 | 3300019255 | Groundwater Sediment | VYLKHLSSLQFLTYVSFFAVVMAALFKFVPGRSPPLRETPYPE |
| Ga0173482_106938801 | 3300019361 | Soil | VYVKHLTSLQFLTYVSFFAVVLAAVFRFVPGRSPPVRETPFPDDELYTH |
| Ga0173479_106029671 | 3300019362 | Soil | VYVKHLTSLQFLTYVSFFAVVLAAVFRFVPGRSPPVRETPFPDDELYTHDRK |
| Ga0193729_12258273 | 3300019887 | Soil | VYLRHLSSLQFLTYCSFFAVVIAAIFRFMPGKAPPFRTHPYP |
| Ga0193728_13442671 | 3300019890 | Soil | MWVKHLSSLQFLTYVAFFGVIVAAICKFVPGRAAPVRETPYPD |
| Ga0179594_102519581 | 3300020170 | Vadose Zone Soil | VYVRHLTSLQFLTYVAFFAVVIAAMFRFIPGKAPPVRTEPYHEDELGAHD |
| Ga0193699_103192543 | 3300021363 | Soil | MWVQHLSSLDFLTYVAFFAVVVAAICRFVPGKAAPVRDEP |
| Ga0182009_103403194 | 3300021445 | Soil | VYLKHLSSLQFLTYVSFFAVVVAALFKFVPGKASPVRVEPY |
| Ga0224452_10189071 | 3300022534 | Groundwater Sediment | VYLKHLSSLQFLTYVAFLVVALAAIWRLVPGKAPPVRT |
| Ga0222622_100223827 | 3300022756 | Groundwater Sediment | VYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPVR |
| Ga0247790_100050851 | 3300022915 | Soil | VYLKHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPP |
| Ga0207653_102613871 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPYSDEELY |
| Ga0207705_101502241 | 3300025909 | Corn Rhizosphere | MWVQHLSSLDFLTYVAFFGVVVAAICRFVPGKAAPVR |
| Ga0207684_105068874 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVKHLSSLQFLTYVAFFSVVVAAICKFVPGRAAPVRDTPY |
| Ga0207646_118154293 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEPY |
| Ga0207690_107861474 | 3300025932 | Corn Rhizosphere | VYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPY |
| Ga0207709_107056494 | 3300025935 | Miscanthus Rhizosphere | VYVRHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPPTR |
| Ga0207668_107877924 | 3300025972 | Switchgrass Rhizosphere | VYVRHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPPTRDEPYSDEELHAHDR |
| Ga0207641_117205951 | 3300026088 | Switchgrass Rhizosphere | VYVKHVTSLQFLTYLSFFAVLVAAMFRFVPGRTPPARTVPY |
| Ga0209687_12399411 | 3300026322 | Soil | MYLKHLSSLQFLTYVAFFSVVVAALFKFVPGKAPPIRTVPYGDDEL |
| Ga0209808_12888971 | 3300026523 | Soil | MWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTEPYGEQELARHD |
| Ga0209590_106477122 | 3300027882 | Vadose Zone Soil | VYLHHLTSLQFLTYVSFFAVVIAALFRFVPGRSPPVREIPYPED |
| Ga0307295_100292725 | 3300028708 | Soil | VYLKHVTSLQFLTYVSFFAVLLAAMFRFVPGRTPPTRDEPYSDEELHAHDR |
| Ga0307293_101402094 | 3300028711 | Soil | VYIKHLTSLQFLTYVSFFAVLLAAMFRFVPGRSPPVREE |
| Ga0307303_101853881 | 3300028713 | Soil | VYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPYSDEE |
| Ga0307311_100215491 | 3300028716 | Soil | VYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPMREVPYPDD |
| Ga0307298_100130401 | 3300028717 | Soil | MWVKHLSSLQFLTYVAFFAVVIAAICKFVPGRAPPVRDEPYPDEELHA |
| Ga0307301_100671651 | 3300028719 | Soil | VYLKHLSSLQFLTYVAFLAVALAAIWRLVPGKAPPVRTE |
| Ga0307301_102275183 | 3300028719 | Soil | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPV |
| Ga0307317_100657341 | 3300028720 | Soil | VYLKHLSSLQFLTYVAFFGVMIGAIAKFVPGRAPPVRETPYTSKE |
| Ga0307297_100068697 | 3300028754 | Soil | VYVKHLTSLQFLTYVAFFAVVIAAMFKFVPGKAPPIR |
| Ga0307282_101474881 | 3300028784 | Soil | MWVQHLSSLDFLTYVAFFGVVVAAICRFVPGKAAPVRDEPFSYEELTRHDAFLA |
| Ga0307282_101527865 | 3300028784 | Soil | MYLKHLSSLQFLTYCAFLGVVIAAIFRFVPGKPAPARTEPYSE |
| Ga0307282_103653784 | 3300028784 | Soil | MWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEP |
| Ga0307282_104419701 | 3300028784 | Soil | MWVQHLSSLDFLTYVAFFGVVVAAICRFVPGRGAPV |
| Ga0307503_105188173 | 3300028802 | Soil | MWVQHLSSFMFLTYVAFFAVLIAAIFVYVPGKAPPIREEP |
| Ga0307305_103324343 | 3300028807 | Soil | MWVQHLSSLDFLTYVAFFGVVVAAICRFVPGKAAPVRDEP |
| Ga0307292_103513963 | 3300028811 | Soil | MWVQHLSSLDFLTYVAFFGVVVAAICRFVPGRGAPVRTEPYPDAELTRHDARL |
| Ga0307296_104417831 | 3300028819 | Soil | MWVKHLSSLQFLTYVAFFAVVIAAICKFVPGRAPPVR |
| Ga0307310_105939633 | 3300028824 | Soil | VYIKHLTSLQFLTYVSFFAVVLAAMFRFIPGRSPPV |
| Ga0307310_106617381 | 3300028824 | Soil | VYVKHLTSLQFLTYVAFFSVVIAAMFKFVPGKAPPVRT |
| Ga0307312_105510291 | 3300028828 | Soil | MWVQHLSSLQFLTYVAFFAVVVAAICKFVPGRAAPVRDTPYP |
| Ga0307308_100168847 | 3300028884 | Soil | MWVKHLSSLQFLTYVAFFAVVVAAICRFVPGKAAPVRQEP |
| Ga0307304_100071377 | 3300028885 | Soil | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEPYPEE |
| Ga0307304_101086361 | 3300028885 | Soil | VYLKHLSSLQFLTYVSFFAVVMAALFKFVPGRSPPV |
| Ga0307304_104283003 | 3300028885 | Soil | MYLKHLSSLQFLTYCAFLGVVIAAIFRFVPGKPAPARTEPYSEEELGA |
| Ga0308193_10005077 | 3300031096 | Soil | VYVKHLTSLQFLTYVAFFAVVIAAMFKFVPGKAPPIREEPYP |
| Ga0310813_119125323 | 3300031716 | Soil | MYLRHLSSLQFLTYCSFFAVVIAAIFRFVPGKAPPVRTTPYSD |
| Ga0310810_100903381 | 3300033412 | Soil | LYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRT |
| ⦗Top⦘ |