NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066970

Metagenome / Metatranscriptome Family F066970

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066970
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 43 residues
Representative Sequence MWVKHLSSLQFLTYVAFFAVVVAAICRFVPGKAAPVRQEP
Number of Associated Samples 105
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.40 %
% of genes near scaffold ends (potentially truncated) 97.62 %
% of genes from short scaffolds (< 2000 bps) 88.89 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.778 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.762 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 36.76%    β-sheet: 0.00%    Coil/Unstructured: 63.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF13442Cytochrome_CBB3 7.94
PF00115COX1 5.56
PF00486Trans_reg_C 0.79
PF00589Phage_integrase 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101855833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300000443|F12B_10098612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300001686|C688J18823_10287882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1082Open in IMG/M
3300003321|soilH1_10365122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300004156|Ga0062589_100343633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300005175|Ga0066673_10733724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300005176|Ga0066679_10187430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300005187|Ga0066675_10071793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2204Open in IMG/M
3300005187|Ga0066675_11360656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300005356|Ga0070674_101986870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300005451|Ga0066681_10954452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300005467|Ga0070706_101528999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300005536|Ga0070697_101516667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300005552|Ga0066701_10524240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300005614|Ga0068856_102555455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300005615|Ga0070702_101537547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300006175|Ga0070712_101438766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300006581|Ga0074048_12149685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2978Open in IMG/M
3300006806|Ga0079220_10819946All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300009012|Ga0066710_101775068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300009101|Ga0105247_11520050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300009137|Ga0066709_101728135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria885Open in IMG/M
3300009137|Ga0066709_103340771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300009545|Ga0105237_11490403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300010147|Ga0126319_1246827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4348Open in IMG/M
3300010147|Ga0126319_1525713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300010320|Ga0134109_10177711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300010325|Ga0134064_10403983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300010326|Ga0134065_10367771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300010329|Ga0134111_10484818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300010335|Ga0134063_10328386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300010336|Ga0134071_10663197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300010364|Ga0134066_10272583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300010375|Ga0105239_10443901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1471Open in IMG/M
3300010396|Ga0134126_11487233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300011003|Ga0138514_100016661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1273Open in IMG/M
3300012198|Ga0137364_10772933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300012201|Ga0137365_10485421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300012201|Ga0137365_10562247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300012204|Ga0137374_10074292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3330Open in IMG/M
3300012208|Ga0137376_11182178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300012208|Ga0137376_11353250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300012285|Ga0137370_10011331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4270Open in IMG/M
3300012285|Ga0137370_10366309All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300012285|Ga0137370_10922104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300012349|Ga0137387_11144168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012353|Ga0137367_10320738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300012353|Ga0137367_10927922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300012359|Ga0137385_10419919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1139Open in IMG/M
3300012359|Ga0137385_10688176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300012361|Ga0137360_10858882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300012683|Ga0137398_10888111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300012891|Ga0157305_10186295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300012896|Ga0157303_10276229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012922|Ga0137394_11513004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300012923|Ga0137359_11311746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300012927|Ga0137416_10990108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria751Open in IMG/M
3300012929|Ga0137404_11830406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300012961|Ga0164302_11677581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300012977|Ga0134087_10110744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300012977|Ga0134087_10687288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300013308|Ga0157375_12871563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300014056|Ga0120125_1150587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300014058|Ga0120149_1156866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300014166|Ga0134079_10013230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2548Open in IMG/M
3300014497|Ga0182008_10605440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300015357|Ga0134072_10017570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1743Open in IMG/M
3300018061|Ga0184619_10246312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300018061|Ga0184619_10421498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300018071|Ga0184618_10152544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria945Open in IMG/M
3300018075|Ga0184632_10427270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300018433|Ga0066667_10621124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria902Open in IMG/M
3300018433|Ga0066667_11903149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300018468|Ga0066662_11638897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300018482|Ga0066669_10409738All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300018482|Ga0066669_11885568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300019255|Ga0184643_1010922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300019255|Ga0184643_1232664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300019361|Ga0173482_10693880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300019362|Ga0173479_10602967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300019887|Ga0193729_1225827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300019890|Ga0193728_1344267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300020170|Ga0179594_10251958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300021363|Ga0193699_10319254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300021445|Ga0182009_10340319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300022534|Ga0224452_1018907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1902Open in IMG/M
3300022756|Ga0222622_10022382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3241Open in IMG/M
3300022915|Ga0247790_10005085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2545Open in IMG/M
3300025885|Ga0207653_10261387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300025909|Ga0207705_10150224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1745Open in IMG/M
3300025910|Ga0207684_10506887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300025922|Ga0207646_11815429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300025932|Ga0207690_10786147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300025935|Ga0207709_10705649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300025972|Ga0207668_10787792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300026088|Ga0207641_11720595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300026322|Ga0209687_1239941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300026523|Ga0209808_1288897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300027882|Ga0209590_10647712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300028708|Ga0307295_10029272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1377Open in IMG/M
3300028711|Ga0307293_10140209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300028713|Ga0307303_10185388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300028716|Ga0307311_10021549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1606Open in IMG/M
3300028717|Ga0307298_10013040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2099Open in IMG/M
3300028719|Ga0307301_10067165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300028719|Ga0307301_10227518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300028720|Ga0307317_10065734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1178Open in IMG/M
3300028754|Ga0307297_10006869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2889Open in IMG/M
3300028784|Ga0307282_10147488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1113Open in IMG/M
3300028784|Ga0307282_10152786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300028784|Ga0307282_10365378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300028784|Ga0307282_10441970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300028802|Ga0307503_10518817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300028807|Ga0307305_10332434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300028811|Ga0307292_10351396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300028819|Ga0307296_10441783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300028824|Ga0307310_10593963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300028824|Ga0307310_10661738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300028828|Ga0307312_10551029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300028884|Ga0307308_10016884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3321Open in IMG/M
3300028885|Ga0307304_10007137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3422Open in IMG/M
3300028885|Ga0307304_10108636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1117Open in IMG/M
3300028885|Ga0307304_10428300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300031096|Ga0308193_1000507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2905Open in IMG/M
3300031716|Ga0310813_11912532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300033412|Ga0310810_10090338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3670Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.38%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.59%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.59%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.79%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10185583343300000364SoilVYLKHLTSLQFLTYLSFFAVVLAALFRFVPGRAPPVR
F12B_1009861213300000443SoilVYLKHLSSLQFLTYVAFLAVALAAIWRLIPGKAPPVRTEPYSDDELGAH
C688J18823_1028788213300001686SoilMWVQHLTSLQFLTYVGFFAVVVAAVMRFLPGAPAPARTEPYGEEEL
soilH1_1036512213300003321Sugarcane Root And Bulk SoilVWVQQLSSLDFLFYAAFFGVVVAAICYAVPGKAPPLREEPYPPEELGRHDARLAK
Ga0062589_10034363313300004156SoilMWVKHLTSLQFLTYVAFFAVVVAAVMRFLPGAPAPARTEPYGEE
Ga0066673_1073372413300005175SoilVYLKHLTSLQFLTYVAFAAVALAAIMRMIPGRTPPARTEPYGHAELRDHDR
Ga0066679_1018743013300005176SoilMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYPEDELYA
Ga0066675_1007179313300005187SoilLYVKHLTSLQFLTYVAFFAVVLAAMFKFVPGKAPPTRDEPYPEDEL
Ga0066675_1136065633300005187SoilMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYP
Ga0070674_10198687033300005356Miscanthus RhizosphereLYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEP
Ga0066681_1095445213300005451SoilLYVKHLTSLQFLTYVAFFAVVLAAMFKFVPGKAPPTRDEP
Ga0070706_10152899913300005467Corn, Switchgrass And Miscanthus RhizosphereMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKASPVRDTPYPDDE
Ga0070697_10151666733300005536Corn, Switchgrass And Miscanthus RhizosphereMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGRATPVRDTPYPDEE
Ga0066701_1052424013300005552SoilVWVQHLSSLQFLTYVAFFAVVVGIVVTVVPGREPP
Ga0068856_10255545513300005614Corn RhizosphereVYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTR
Ga0070702_10153754733300005615Corn, Switchgrass And Miscanthus RhizosphereMWVKHLSSLQFLTYVAFFAVVIAAICKFVPGRAPPVREEPYPDE
Ga0070712_10143876633300006175Corn, Switchgrass And Miscanthus RhizosphereVYVKHLTSLQFLTYVAFFAVVIAAMFRFIPGKAPPVRTERYSEDEL
Ga0074048_1214968513300006581SoilMWVQHLSSLQFLTYVAFFAVVIAAICRFVPGRAPPVRETPYPDEEL
Ga0079220_1081994623300006806Agricultural SoilMWVKHLSSLQFLTYVAFFAVGIAAICKFVPGKAAPVR*
Ga0066710_10177506813300009012Grasslands SoilLYLRHLSSLQFLTYAAFFAVVIAAIVRFLPGVAPPVRTEPYDDDELG
Ga0105247_1152005013300009101Switchgrass RhizosphereVYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPYSDEELYA
Ga0066709_10172813543300009137Grasslands SoilMWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTEPYGEQELAR
Ga0066709_10334077133300009137Grasslands SoilVYVKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEPYPED
Ga0105237_1149040313300009545Corn RhizosphereLYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEPYPEDELGAHD
Ga0126319_124682773300010147SoilMWIKHLSSLQFLTYVAFFGVVVAAVFEFMPGRSPPLRREPYPE
Ga0126319_152571363300010147SoilVYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPVREVPYPDEELHAH
Ga0134109_1017771133300010320Grasslands SoilLYVKHLTSLQFLTYVAFFAVVLGAMFRFVPGKAPPVRREPYPE
Ga0134064_1040398333300010325Grasslands SoilVYVKHLTSLQFLTYVAFFSVVIAAIFKFMPGKAPPVRT
Ga0134065_1036777123300010326Grasslands SoilMWVRHLSSLQFLTYVAFFAVVIAAIAKFVPGRSPPVREEPYPDEELHAHD
Ga0134111_1048481813300010329Grasslands SoilMWIKHLSSLQFLTYVAFFGVVITAICRFVPGRAPPLREEPYP
Ga0134063_1032838643300010335Grasslands SoilMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPV
Ga0134071_1066319733300010336Grasslands SoilMWIKHPSSLQFLTYVAFFAVVVAAICKFVPGRAAPVRDTPYPDDELHAH
Ga0134066_1027258313300010364Grasslands SoilMWVKHLSSLQFLTYVAFFAVVIAGICRFVPGRAAPVREEPYPDEEL
Ga0105239_1044390113300010375Corn RhizosphereLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEPYPEDELGAHD
Ga0134126_1148723313300010396Terrestrial SoilLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRS
Ga0138514_10001666153300011003SoilVYVKHLTSLQFLTYVAFFAVVLSAMFKFVPGKAPPVRTDPY
Ga0137364_1077293333300012198Vadose Zone SoilLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVR
Ga0137365_1048542143300012201Vadose Zone SoilVWIRHLSSLQFLTYVAFFAIVIASIVTIVPGRAPPLRRESYPDDELGR
Ga0137365_1056224713300012201Vadose Zone SoilMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYPDEELYAH
Ga0137374_1007429213300012204Vadose Zone SoilVYLKHLTSLQFLTYVGFFTVLLAVLWRLLPGKTPPLRTEPFLEEKL
Ga0137376_1118217833300012208Vadose Zone SoilMWIKHLSSLQFLTYVAFFAVVVAAICKFVPGRAAPVRDTPYPDDELHAHDRKT
Ga0137376_1135325033300012208Vadose Zone SoilMYLRHLSSLQFLTYASFFGVVIAAMFRFMPGKAPPVRTEP
Ga0137370_1001133113300012285Vadose Zone SoilMWVRHLTSLQFLTYVAFFAVVIAAVMRFLPGAPAPVRTEPYDEEELGRHDRR
Ga0137370_1036630923300012285Vadose Zone SoilMWVQHLSSLQFLTYVAFFAVVVAAICKFVPGKAAPVRETPYPEDELYAHDRKT
Ga0137370_1092210433300012285Vadose Zone SoilVYLRHLSSLQFLTYASFFAVVVAALFRFLPGKKPPLRYEPYTDEELGA
Ga0137387_1114416833300012349Vadose Zone SoilVYVRHLTSLQFLTYVAFFAVVIAAMFRFVPGKTPPVRTEPYSEDEL
Ga0137367_1032073813300012353Vadose Zone SoilVYLKHLSSLQFLTYAAFFGVVVAALIRFLPGRAPP
Ga0137367_1092792213300012353Vadose Zone SoilMWVKHLSSLQFLTYVAFFAVVVAAICKFVPGKAAP
Ga0137385_1041991953300012359Vadose Zone SoilLYVRHLTSLQFLTYVAFFAVVIAAMFRFVPGKAPQVRTEPYSEDELGAHDR
Ga0137385_1068817613300012359Vadose Zone SoilLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEP*
Ga0137360_1085888243300012361Vadose Zone SoilMWVQHLSSLDFLTYVAFFGVVVAVICRFAPGKAAPVRTEPYSEDELARH
Ga0137398_1088811113300012683Vadose Zone SoilMWVQHLSSLDFLTYVAFFAVVVAAICRFVPGKAAPVRDEPFP
Ga0157305_1018629533300012891SoilVYLKHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPATRD
Ga0157303_1027622933300012896SoilVYVKHLTSLQFLTYVSFFAVVLAAVFRFVPGRSPPVRETPFPDDELY
Ga0137394_1151300433300012922Vadose Zone SoilMWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEPYSED
Ga0137359_1131174633300012923Vadose Zone SoilLYVRHLTSLQFLTYVGFFAVVLAAMLRFVPGKAPPTRDEPYLED
Ga0137416_1099010843300012927Vadose Zone SoilVWIRHLSSLQFLTYVAFFAIVVASIVTIVPGRAPPLREEPY
Ga0137404_1183040613300012929Vadose Zone SoilMWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEPYSEDELA
Ga0164302_1167758113300012961SoilLYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEPYPEDELGAH
Ga0134087_1011074413300012977Grasslands SoilMWVRHLSSLQFLTYVAFFAVVIAAIAKFVPGRSPPVREEPYPDEEL
Ga0134087_1068728833300012977Grasslands SoilMWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTEPYGEQELARHDG
Ga0157375_1287156313300013308Miscanthus RhizosphereVYVKHVTSLQFLTYLSFFAVLVAAMFRFVPGRTPPARTVP
Ga0120125_115058713300014056PermafrostLYVKHLTSLQFLTYVGFFTVVLAAMFKFVPGKAPPVRTEPYSEDEL
Ga0120149_115686633300014058PermafrostLYVQHLSSLQFLTYVAFFAVVIAAIAKFVPGRAAPVREEP
Ga0134079_1001323013300014166Grasslands SoilMWVRHLTSLQFLTYVAFFAVVVAAVMRFLPGAPAPARTEP
Ga0182008_1060544013300014497RhizosphereMWVKHLSSLQFLTYVAFFAVVVAAICRFVPGKASPV
Ga0134072_1001757063300015357Grasslands SoilLYVKHLTSLQFLTYVAFFAVVLAAMFKFVPGKAPPTRDEPYP
Ga0184619_1024631243300018061Groundwater SedimentMWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEPYSEDELARH
Ga0184619_1042149833300018061Groundwater SedimentVYVQHLSSLQFLTYVAFFTVVVAAICKFVPGRAAPVRDTPYPDEE
Ga0184618_1015254443300018071Groundwater SedimentMWVKHLSSFQFLTYVAFFAVVVAAICKFVPGKAAPVRET
Ga0184632_1042727013300018075Groundwater SedimentVYLKHLSSLQFLTYVAFLVVALAAIWRLVPGKAPPVRTE
Ga0066667_1062112443300018433Grasslands SoilMYLRHLSTLQFVTYASFFGVVVAALFRFLPGKKPPVRLEPYPEAELV
Ga0066667_1190314933300018433Grasslands SoilVYLRHLSTLQFVTYASFFGVVVAALFRFLPGKKPPLPLE
Ga0066662_1163889713300018468Grasslands SoilVWVKHLSSLQFLTYVAFFAVVVAAICKFVPGRAAP
Ga0066669_1040973823300018482Grasslands SoilMWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTER
Ga0066669_1188556833300018482Grasslands SoilMWIKHLSSLQFLTYVAFFGVVVAAICKFVPGRAAPVRDTPYPDD
Ga0184643_101092243300019255Groundwater SedimentVYVKHLTSLQFLTYVAFFTVVLAAMFKFVPGKAPPVRTEPYSEDELGAH
Ga0184643_123266413300019255Groundwater SedimentVYLKHLSSLQFLTYVSFFAVVMAALFKFVPGRSPPLRETPYPE
Ga0173482_1069388013300019361SoilVYVKHLTSLQFLTYVSFFAVVLAAVFRFVPGRSPPVRETPFPDDELYTH
Ga0173479_1060296713300019362SoilVYVKHLTSLQFLTYVSFFAVVLAAVFRFVPGRSPPVRETPFPDDELYTHDRK
Ga0193729_122582733300019887SoilVYLRHLSSLQFLTYCSFFAVVIAAIFRFMPGKAPPFRTHPYP
Ga0193728_134426713300019890SoilMWVKHLSSLQFLTYVAFFGVIVAAICKFVPGRAAPVRETPYPD
Ga0179594_1025195813300020170Vadose Zone SoilVYVRHLTSLQFLTYVAFFAVVIAAMFRFIPGKAPPVRTEPYHEDELGAHD
Ga0193699_1031925433300021363SoilMWVQHLSSLDFLTYVAFFAVVVAAICRFVPGKAAPVRDEP
Ga0182009_1034031943300021445SoilVYLKHLSSLQFLTYVSFFAVVVAALFKFVPGKASPVRVEPY
Ga0224452_101890713300022534Groundwater SedimentVYLKHLSSLQFLTYVAFLVVALAAIWRLVPGKAPPVRT
Ga0222622_1002238273300022756Groundwater SedimentVYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPVR
Ga0247790_1000508513300022915SoilVYLKHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPP
Ga0207653_1026138713300025885Corn, Switchgrass And Miscanthus RhizosphereVYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPYSDEELY
Ga0207705_1015022413300025909Corn RhizosphereMWVQHLSSLDFLTYVAFFGVVVAAICRFVPGKAAPVR
Ga0207684_1050688743300025910Corn, Switchgrass And Miscanthus RhizosphereMWVKHLSSLQFLTYVAFFSVVVAAICKFVPGRAAPVRDTPY
Ga0207646_1181542933300025922Corn, Switchgrass And Miscanthus RhizosphereLYIKHLTSLQFLTYVGFFAIVLAAMFKFVPGKAPPVRTEPY
Ga0207690_1078614743300025932Corn RhizosphereVYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPY
Ga0207709_1070564943300025935Miscanthus RhizosphereVYVRHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPPTR
Ga0207668_1078779243300025972Switchgrass RhizosphereVYVRHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPPTRDEPYSDEELHAHDR
Ga0207641_1172059513300026088Switchgrass RhizosphereVYVKHVTSLQFLTYLSFFAVLVAAMFRFVPGRTPPARTVPY
Ga0209687_123994113300026322SoilMYLKHLSSLQFLTYVAFFSVVVAALFKFVPGKAPPIRTVPYGDDEL
Ga0209808_128889713300026523SoilMWVQHLSSLDFLTYVAFFAVVVAVICRFVPGKAAPVRTEPYGEQELARHD
Ga0209590_1064771223300027882Vadose Zone SoilVYLHHLTSLQFLTYVSFFAVVIAALFRFVPGRSPPVREIPYPED
Ga0307295_1002927253300028708SoilVYLKHVTSLQFLTYVSFFAVLLAAMFRFVPGRTPPTRDEPYSDEELHAHDR
Ga0307293_1014020943300028711SoilVYIKHLTSLQFLTYVSFFAVLLAAMFRFVPGRSPPVREE
Ga0307303_1018538813300028713SoilVYLKHVTSLQFLTYLSFFAVLLAAMFRYVPGRAPQTRDEPYSDEE
Ga0307311_1002154913300028716SoilVYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPMREVPYPDD
Ga0307298_1001304013300028717SoilMWVKHLSSLQFLTYVAFFAVVIAAICKFVPGRAPPVRDEPYPDEELHA
Ga0307301_1006716513300028719SoilVYLKHLSSLQFLTYVAFLAVALAAIWRLVPGKAPPVRTE
Ga0307301_1022751833300028719SoilLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPV
Ga0307317_1006573413300028720SoilVYLKHLSSLQFLTYVAFFGVMIGAIAKFVPGRAPPVRETPYTSKE
Ga0307297_1000686973300028754SoilVYVKHLTSLQFLTYVAFFAVVIAAMFKFVPGKAPPIR
Ga0307282_1014748813300028784SoilMWVQHLSSLDFLTYVAFFGVVVAAICRFVPGKAAPVRDEPFSYEELTRHDAFLA
Ga0307282_1015278653300028784SoilMYLKHLSSLQFLTYCAFLGVVIAAIFRFVPGKPAPARTEPYSE
Ga0307282_1036537843300028784SoilMWVQHLSSLDFLTYVAFFGVVVAVICRFVPGKAAPVRTEP
Ga0307282_1044197013300028784SoilMWVQHLSSLDFLTYVAFFGVVVAAICRFVPGRGAPV
Ga0307503_1051881733300028802SoilMWVQHLSSFMFLTYVAFFAVLIAAIFVYVPGKAPPIREEP
Ga0307305_1033243433300028807SoilMWVQHLSSLDFLTYVAFFGVVVAAICRFVPGKAAPVRDEP
Ga0307292_1035139633300028811SoilMWVQHLSSLDFLTYVAFFGVVVAAICRFVPGRGAPVRTEPYPDAELTRHDARL
Ga0307296_1044178313300028819SoilMWVKHLSSLQFLTYVAFFAVVIAAICKFVPGRAPPVR
Ga0307310_1059396333300028824SoilVYIKHLTSLQFLTYVSFFAVVLAAMFRFIPGRSPPV
Ga0307310_1066173813300028824SoilVYVKHLTSLQFLTYVAFFSVVIAAMFKFVPGKAPPVRT
Ga0307312_1055102913300028828SoilMWVQHLSSLQFLTYVAFFAVVVAAICKFVPGRAAPVRDTPYP
Ga0307308_1001688473300028884SoilMWVKHLSSLQFLTYVAFFAVVVAAICRFVPGKAAPVRQEP
Ga0307304_1000713773300028885SoilLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRTEPYPEE
Ga0307304_1010863613300028885SoilVYLKHLSSLQFLTYVSFFAVVMAALFKFVPGRSPPV
Ga0307304_1042830033300028885SoilMYLKHLSSLQFLTYCAFLGVVIAAIFRFVPGKPAPARTEPYSEEELGA
Ga0308193_100050773300031096SoilVYVKHLTSLQFLTYVAFFAVVIAAMFKFVPGKAPPIREEPYP
Ga0310813_1191253233300031716SoilMYLRHLSSLQFLTYCSFFAVVIAAIFRFVPGKAPPVRTTPYSD
Ga0310810_1009033813300033412SoilLYIKHLTSLQFLTYVGFFAVVLAAMFKFVPGKAPPVRT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.