NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207684_10506887

Scaffold Ga0207684_10506887


Overview

Basic Information
Taxon OID3300025910 Open in IMG/M
Scaffold IDGa0207684_10506887 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1034
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F000805Metagenome / Metatranscriptome883Y
F001079Metagenome / Metatranscriptome785Y
F066970Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0207684_105068871F000805AGGAGMAMPSGDSPEKAQKFYHYLQGHQETMQSAATWHVRWLDLAWLWGFVIALVVAILLWIWQYRSTRQGRTLYPVDSFGGYTTELAGPATFFFIVLTVVLTGWAVALIVGHLVWGQKF
Ga0207684_105068872F001079AGAAGMATPVPSALPYVAWASATFAEIPVADWETVYASMQALKAHVQEYPGCQKLEAFVELAGAGAVRVDCYTVWDTPEQLDAFLERGYTFERMLKAVANLSAEPTRVMEKVF
Ga0207684_105068873F000280AGAAGGMAEEPRTRPARPLVGYRDVGEDVRHSRRAETRAWVILAGLMAIYLGWTLVIYFLEPGLR
Ga0207684_105068874F066970N/AMWVKHLSSLQFLTYVAFFSVVVAAICKFVPGRAAPVRDTPY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.