| Basic Information | |
|---|---|
| Taxon OID | 3300025834 Open in IMG/M |
| Scaffold ID | Ga0209100_1253469 Open in IMG/M |
| Source Dataset Name | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - lysozymeSSSS metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 562 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Borup Fiord, Nunavut, Canada | |||||||
| Coordinates | Lat. (o) | 81.017 | Long. (o) | -81.583 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021141 | Metagenome | 220 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209100_12534691 | F021141 | N/A | LRVRWLATDGVPGDGYKAQVTAIKLPKGVSLAMDASSILEQSHADVSGGLGAYSVTFQGMVGYAHDHPDRAHVDGFEDQEIEYVLEFVHEESGRVAVDNEDYKVVEQPRGWAHKLNKRAPSQPASES |
| ⦗Top⦘ |