Scaffold Ga0208325_1031452

Overview

Basic Information

• Taxon OID: 3300025824
• Scaffold ID: Ga0208325_1031452
• Source Dataset Name: Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1210
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 50.0621
  • Long. (^o): -124.7214
  • Depth (m): 330

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038536	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208325_10314522	F038536	GGAGG	VNLQILRRRAEMLDAVCTGLHPSAVISQLAEKYDISEKALWSDWLRREKWVPLLLELEKFADFSGMVVERLNGVQKAAWSIYLKASNDSARVGALRTVLEALEIHRDVIQTMDVLDRLDQLEEVAKERCSTFKRGGGSLH