NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209102_1008642

Scaffold Ga0209102_1008642


Overview

Basic Information
Taxon OID3300025794 Open in IMG/M
Scaffold IDGa0209102_1008642 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2852
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.4127Long. (o)-118.504Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043157Metagenome / Metatranscriptome157Y
F094910Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0209102_10086422F094910AGGAGGVRKLLSIGLVLALLVTFIVPVAVLAQDECCEYTPPECGPLPAKNTKTLAGAAVWSLLAITDIMGKAVCATTGQLACNLGGWSDQLGVVAVDVTAVGLEGVAGLLEYVMDAFVGMPDLGKALGDLLRGIADAIAGIEE
Ga0209102_10086423F043157GGAGGMRIQGKCFRNCVCLSIQKRTERMQRELIIISRAKSLERRIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.