Scaffold Ga0207865_113830

Overview

Basic Information

• Taxon OID: 3300025529
• Scaffold ID: Ga0207865_113830
• Source Dataset Name: Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-D (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1591
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location

• Location Name: Joint BioEnergy Institute, California, USA
• Coordinates
  • Lat. (^o): 38.5402
  • Long. (^o): -121.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020484	Metagenome / Metatranscriptome	223	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207865_1138302	F020484	AGGA	MARTLDVARSEIRDRLQRWDKMDTTLLFGINFGRIRTRWKEKFVHFAMEQCFSTGSVLEIERKIREDEAAMGQRGIEGGDDDVKQ