| Basic Information | |
|---|---|
| Taxon OID | 3300025528 Open in IMG/M |
| Scaffold ID | Ga0207867_1000424 Open in IMG/M |
| Source Dataset Name | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-D (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 44717 |
| Total Scaffold Genes | 37 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 32 (86.49%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Joint BioEnergy Institute, California, USA | |||||||
| Coordinates | Lat. (o) | 38.5402 | Long. (o) | -121.75 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018530 | Metagenome / Metatranscriptome | 234 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207867_100042437 | F018530 | AGGAG | MIQGLPGVSQTTRDFVQLVRLFLRDFPELNRLIAGVESTDRQIAWAIMDALADFNGTPPFTTFTLDDLLYRNQHNLMLRMTVISILESVAMLQVRNHINYSNGGITVGVNDKAPELMRWLQYFKATTDQMKQRVKVALNIEGILGSSNMGVSSEYWAVNSTYAAY |
| ⦗Top⦘ |