| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025528 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110114 | Gp0061318 | Ga0207867 |
| Sample Name | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-D (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 191876369 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Joint BioEnergy Institute, California, USA | |||||||
| Coordinates | Lat. (o) | 38.5402 | Long. (o) | -121.75 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007999 | Metagenome | 341 | Y |
| F018530 | Metagenome / Metatranscriptome | 234 | Y |
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0207867_1000424 | Not Available | 44717 | Open in IMG/M |
| Ga0207867_1019906 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| Ga0207867_1031765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 847 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0207867_1000424 | Ga0207867_100042437 | F018530 | MIQGLPGVSQTTRDFVQLVRLFLRDFPELNRLIAGVESTDRQIAWAIMDALADFNGTPPFTTFTLDDLLYRNQHNLMLRMTVISILESVAMLQVRNHINYSNGGITVGVNDKAPELMRWLQYFKATTDQMKQRVKVALNIEGILGSSNMGVSSEYWAVNSTYAAY |
| Ga0207867_1019906 | Ga0207867_10199061 | F036417 | TVLVRLDTDDGVVTFRARWHRSALELQRAILFRLRQGHPLWFEDEWGHSHCFKPERVWGALVDGR |
| Ga0207867_1031765 | Ga0207867_10317653 | F007999 | ARAARARANLVAALRECCELADAVEAFEGEELLEVLSHLDGLRFVMAESAQILQGVVRGLEAYEK |
| ⦗Top⦘ |