Scaffold Ga0207869_1023205

Overview

Basic Information

• Taxon OID: 3300025517
• Scaffold ID: Ga0207869_1023205
• Source Dataset Name: Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-D (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 939
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location

• Location Name: Joint BioEnergy Institute, California, USA
• Coordinates
  • Lat. (^o): 38.5402
  • Long. (^o): -121.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061597	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207869_10232052	F061597	N/A	LDKLTDQPGNLIPLDRAEVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA