Scaffold Ga0209758_1062422

Overview

Basic Information

• Taxon OID: 3300025297
• Scaffold ID: Ga0209758_1062422
• Source Dataset Name: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1220
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9082
  • Long. (^o): -79.0499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080316	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209758_10624221	F080316	AGG	MVIEEEILARIRAAKTWDSSARVEDFQVQAADNGFVLINLKTRRAQLLYDEDSELSDLEQLFPENEKRYRGLL