Scaffold Ga0209673_1014991

Overview

Basic Information

• Taxon OID: 3300025273
• Scaffold ID: Ga0209673_1014991
• Source Dataset Name: Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2969
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.6667
  • Long. (^o): -78.5097

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092690	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209673_10149912	F092690	GAG	VSDTRFPDDRKARLVRNLLALRTVLAMDQMQTGRWSERIEEIDEELAGLGHDMKSIAAFATESLRRTFLLPRLVNRRKRAAHRRLGREAPQE