Scaffold Ga0208830_1021720

Overview

Basic Information

• Taxon OID: 3300025238
• Scaffold ID: Ga0208830_1021720
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP2634 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1273
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Northeast of Antigua and Barbuda, North Atlantic Ocean
• Coordinates
  • Lat. (^o): 20.0
  • Long. (^o): -52.63
  • Depth (m): 4002.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085813	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208830_10217201	F085813	N/A	IGIGALNYGLNAYQKGFRRLLKWDVIFLIILNTLMFVPLSLIVGL